Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|335
Gene name
LocationContig_1073:592..2616
Strand-
Gene length (bp)2024
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.1E-24 98 233
PF08031 BBE Berberine and berberine like 1.5E-06 481 522

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 74 519 2.0E-22
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 69 525 6.0E-22
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 74 523 3.0E-14
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 100 523 6.0E-10
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 1 340 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 74 519 2.0E-22
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 69 525 6.0E-22
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 74 523 3.0E-14
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 100 523 6.0E-10
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 1 340 6.0E-08
sp|Q8C0I1|ADAS_MOUSE Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Mus musculus GN=Agps PE=1 SV=1 100 266 7.0E-08
sp|Q9EQR2|ADAS_RAT Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Rattus norvegicus GN=Agps PE=2 SV=1 100 269 1.0E-07
sp|P97275|ADAS_CAVPO Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Cavia porcellus GN=AGPS PE=1 SV=1 100 269 5.0E-07
sp|O00116|ADAS_HUMAN Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens GN=AGPS PE=1 SV=1 100 269 9.0E-07
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 73 285 3.0E-06
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 196 269 5.0E-06
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 95 347 5.0E-06
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 99 263 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|335
MMILLPLILATGFQHAATFAGAEHQASEHQDSASCPSNAVHAIDQNPDALSLSTRSPARLLLSPAHNWSARTVIA
FPGQRQFHDLTERWSVYAPPTYSAVISPATEQDLVKIVNLATRHNLSFLATGGRHGYGTTLGKLRNGLAIDLGQL
DDIDIDQTAGTLTVGPGVLMGDVMLPVHDAGYQIQTSSCTTPSMIGVTLGGGITRWSGIYGLISDALTSARIVTA
SGQVVDVSHKSHPNLFWGLRGAGFNFGIVTRASYQLHSLPSAARSVVNLDLIFSANQTAAYFALLASYSASMPAR
LVISTAILWHADTNAPALRANWVYLGPEPDAQRAMAPVLQLVPLVANMSVVAWHELLSVQRFGVDAKSSVKGSLR
AVYTVNVRQLEAAAFEAAFTTMAGFYAAHPGAQNSFVEFETFPNQAAASVPGNTSAYPWRDAVGNFLFVFSWNQG
DSAAAQASTLVGNHLRQTFAQSSGYPHLSVYVSYAHGDEPLESIYGAEQLPRLAALKKEWDPSNVFAYNNPLPTQ
YQDAQRFLTPSLA*
Coding >OphauG2|335
ATGATGATTCTTTTGCCGCTCATCCTTGCAACTGGCTTCCAACATGCCGCTACATTTGCGGGTGCCGAGCATCAA
GCCTCAGAGCATCAAGATTCAGCCTCCTGTCCCAGCAATGCCGTGCATGCAATTGACCAGAATCCAGATGCTCTC
AGCTTGAGCACTCGCAGCCCAGCCCGTCTGCTTCTCAGCCCCGCCCACAACTGGTCGGCGCGAACCGTCATTGCC
TTCCCCGGCCAGCGCCAATTCCACGACCTGACTGAGCGATGGAGCGTCTACGCCCCTCCGACCTACTCGGCCGTC
ATCAGCCCCGCGACGGAGCAAGACTTGGTCAAGATTGTCAACCTCGCCACTCGGCATAATCTATCCTTTCTCGCC
ACCGGCGGCCGACACGGATACGGCACCACGCTTGGGAAGCTCAGAAACGGCCTGGCCATTGACCTCGGCCAACTC
GATGACATTGACATTGACCAGACTGCCGGAACGCTGACTGTTGGCCCCGGGGTTCTCATGGGCGACGTGATGCTC
CCAGTCCATGATGCGGGATACCAGATTCAAACAAGCTCATGCACCACGCCCAGCATGATTGGCGTCACTCTCGGC
GGCGGCATCACTCGCTGGTCTGGAATCTACGGCCTCATCTCCGACGCCTTGACTTCCGCACGCATCGTAACTGCC
AGCGGCCAAGTCGTGGACGTCAGCCACAAGTCACACCCAAATCTCTTTTGGGGCCTGCGCGGCGCCGGCTTCAAC
TTTGGCATCGTGACAAGGGCCTCGTACCAGCTTCACAGCCTGCCCTCTGCCGCCCGCTCCGTCGTCAATCTCGAC
CTCATCTTTTCCGCCAACCAGACCGCTGCCTACTTTGCCCTTTTAGCATCCTACAGCGCATCCATGCCGGCGCGC
CTTGTCATTTCCACCGCCATCCTCTGGCACGCAGACACCAACGCGCCTGCACTTCGAGCCAATTGGGTCTACCTA
GGCCCCGAGCCCGACGCCCAACGAGCAATGGCCCCCGTCCTCCAACTCGTACCGCTCGTGGCCAACATGAGCGTC
GTTGCATGGCACGAGCTGCTCTCGGTGCAGCGCTTTGGCGTCGATGCCAAAAGCTCCGTCAAGGGGTCCCTTCGA
GCCGTCTACACCGTCAATGTCCGCCAGCTCGAGGCCGCTGCGTTTGAAGCTGCCTTTACCACCATGGCAGGCTTT
TATGCAGCTCACCCCGGCGCACAAAACAGCTTTGTCGAGTTTGAAACCTTTCCCAATCAAGCCGCGGCCTCGGTC
CCGGGAAATACGAGTGCGTATCCATGGCGAGACGCAGTCGGCAATTTTCTCTTTGTCTTTTCCTGGAATCAAGGC
GACTCCGCCGCCGCCCAAGCTTCAACCCTCGTCGGAAACCATCTCCGCCAGACATTTGCCCAGAGCTCTGGATAC
CCCCATCTATCCGTCTACGTCAGCTACGCGCACGGCGACGAGCCTCTTGAGAGCATCTACGGCGCCGAGCAGCTG
CCTCGCCTGGCTGCTCTTAAAAAGGAATGGGATCCCTCCAATGTGTTTGCCTATAATAATCCGTTGCCTACACAG
TACCAAGACGCCCAGCGTTTTTTGACGCCGTCTCTGGCATAG
Transcript >OphauG2|335
ATGATGATTCTTTTGCCGCTCATCCTTGCAACTGGCTTCCAACATGCCGCTACATTTGCGGGTGCCGAGCATCAA
GCCTCAGAGCATCAAGATTCAGCCTCCTGTCCCAGCAATGCCGTGCATGCAATTGACCAGAATCCAGATGCTCTC
AGCTTGAGCACTCGCAGCCCAGCCCGTCTGCTTCTCAGCCCCGCCCACAACTGGTCGGCGCGAACCGTCATTGCC
TTCCCCGGCCAGCGCCAATTCCACGACCTGACTGAGCGATGGAGCGTCTACGCCCCTCCGACCTACTCGGCCGTC
ATCAGCCCCGCGACGGAGCAAGACTTGGTCAAGATTGTCAACCTCGCCACTCGGCATAATCTATCCTTTCTCGCC
ACCGGCGGCCGACACGGATACGGCACCACGCTTGGGAAGCTCAGAAACGGCCTGGCCATTGACCTCGGCCAACTC
GATGACATTGACATTGACCAGACTGCCGGAACGCTGACTGTTGGCCCCGGGGTTCTCATGGGCGACGTGATGCTC
CCAGTCCATGATGCGGGATACCAGATTCAAACAAGCTCATGCACCACGCCCAGCATGATTGGCGTCACTCTCGGC
GGCGGCATCACTCGCTGGTCTGGAATCTACGGCCTCATCTCCGACGCCTTGACTTCCGCACGCATCGTAACTGCC
AGCGGCCAAGTCGTGGACGTCAGCCACAAGTCACACCCAAATCTCTTTTGGGGCCTGCGCGGCGCCGGCTTCAAC
TTTGGCATCGTGACAAGGGCCTCGTACCAGCTTCACAGCCTGCCCTCTGCCGCCCGCTCCGTCGTCAATCTCGAC
CTCATCTTTTCCGCCAACCAGACCGCTGCCTACTTTGCCCTTTTAGCATCCTACAGCGCATCCATGCCGGCGCGC
CTTGTCATTTCCACCGCCATCCTCTGGCACGCAGACACCAACGCGCCTGCACTTCGAGCCAATTGGGTCTACCTA
GGCCCCGAGCCCGACGCCCAACGAGCAATGGCCCCCGTCCTCCAACTCGTACCGCTCGTGGCCAACATGAGCGTC
GTTGCATGGCACGAGCTGCTCTCGGTGCAGCGCTTTGGCGTCGATGCCAAAAGCTCCGTCAAGGGGTCCCTTCGA
GCCGTCTACACCGTCAATGTCCGCCAGCTCGAGGCCGCTGCGTTTGAAGCTGCCTTTACCACCATGGCAGGCTTT
TATGCAGCTCACCCCGGCGCACAAAACAGCTTTGTCGAGTTTGAAACCTTTCCCAATCAAGCCGCGGCCTCGGTC
CCGGGAAATACGAGTGCGTATCCATGGCGAGACGCAGTCGGCAATTTTCTCTTTGTCTTTTCCTGGAATCAAGGC
GACTCCGCCGCCGCCCAAGCTTCAACCCTCGTCGGAAACCATCTCCGCCAGACATTTGCCCAGAGCTCTGGATAC
CCCCATCTATCCGTCTACGTCAGCTACGCGCACGGCGACGAGCCTCTTGAGAGCATCTACGGCGCCGAGCAGCTG
CCTCGCCTGGCTGCTCTTAAAAAGGAATGGGATCCCTCCAATGTGTTTGCCTATAATAATCCGTTGCCTACACAG
TACCAAGACGCCCAGCGTTTTTTGACGCCGTCTCTGGCATAG
Gene >OphauG2|335
ATGATGATTCTTTTGCCGCTCATCCTTGCAACTGGCTTCCAACATGCCGCTACATTTGCGGGTGCCGAGCATCAA
GCCTCAGAGCATCAAGATTCAGCCTCCTGTCCCAGCAATGCCGTGCATGCAATTGACCAGAATCCAGATGCTCTC
AGCTTGAGCACTCGCAGCCCAGCCCGTCTGCTTCTCAGCCCCGCCCACAACTGGTCGGCGCGAACCGTCATTGCC
TTCCCCGGCCAGCGCCAATTCCACGACCTGACTGAGCGATGGAGCGTCTACGCCCCTCCGACCTACTCGGCCGTC
ATCAGCCCCGCGACGGAGCAAGACTTGGTCAAGATTGTATGCAGCAAGAAGAAGAGAAAAAAAAAACATGGCCTC
AACGACTGCTGACAATCGTCTCCCAAATCTATAGGTCAACCTCGCCACTCGGCATAATCTATCCTTTCTCGCCAC
CGGCGGCCGACACGGATACGGCACCACGCTTGGGAAGCTCAGAAACGGCCTGGCCATTGACCTCGGCCAACTCGA
TGACATTGACATTGACCAGACTGCCGGAACGCTGACTGTTGGCCCCGGGGTTCTCATGGGCGACGTGATGCTCCC
AGTCCATGATGCGGGATACCAGATTCGTAAGTCTACCAAGTTTTAGGCCCTCGACGTCTTGTTAACTCGGAGCCT
TTACAAAAAAAAAAAAAATACAAAAAAAAAAGAAACAAGCTCATGCACCACGCCCAGCATGATTGGCGTCACTCT
CGGCGGCGGCATCACTCGCTGGTCTGGAATCTACGGCCTCATCTCCGACGCCTTGACTTCCGCACGCATCGTAAC
TGCCAGCGGCCAAGTCGTGGACGTCAGCCACAAGTCACACCCAAATCTCTTTTGGGGCCTGCGCGGCGCCGGCTT
CAACTTTGGCATCGTGACAAGGGCCTCGTACCAGCTTCACAGCCTGCCCTCTGCCGCCCGCTCCGTCGTCAATCT
CGACCTCATCTTTTCCGCCAACCAGACCGCTGCCTACTTTGCCCTTTTAGCATCCTACAGCGCATCCATGCCGGC
GCGCCTTGTCATTTCCACCGCCATCCTCTGGCACGCAGACACCAACGCGGTAAAGACGAAAGAAGAAGAAACTCC
CCTCTCCCAGCATACAACTAACTCTTGATTGCCCCCCCCCCCCCCCCCCCCCCCCTCTCCAGCCTGCACTTCGAG
CCAATTGGGTCTACCTAGGCCCCGAGCCCGACGCCCAACGAGCAATGGCCCCCGTCCTCCAACTCGTACCGCTCG
TGGCCAACATGAGCGTCGTTGCATGGCACGAGCTGCTCTCGGTGCAGCGCTTTGGCGTCGATGCCAAAAGCTCCG
TCAAGGGGTCCCTTCGAGCCGTCTACACCGTCAATGTCCGCCAGCTCGAGGCCGCTGCGTTTGAAGCTGCCTTTA
CCACCATGGCAGGCTTTTATGCAGCTCACCCCGGCGCACAAAACAGCTTTGTCGAGTTTGAAACCTTTCCCAATC
AAGCCGCGGCCTCGGTCCCGGGAAATACGAGTGCGTATCCATGGCGAGACGCAGTCGGCAATTTGTACGTTGTCT
TGAACACCCCTTTTTTTTCTTCAACACCACCTTTCTTATTCAAAGACCAAAAAAGAAAAGAAAAAAAAGAAAAAA
AAGAAAAAAAAAGAAAAGAAAAAAGAAAAAAAAAAAGAGAAAAGAGTGGACAATGCCACTAATGACTCGGGACGT
ATAGTCTCTTTGTCTTTTCCTGGAATCAAGGCGACTCCGCCGCCGCCCAAGCTTCAACCCTCGTCGGAAACCATC
TCCGCCAGACATTTGCCCAGAGCTCTGGATACCCCCATCTATCCGTCTACGTCAGCTACGCGCACGGCGACGAGC
CTCTTGAGAGCATCTACGGCGCCGAGCAGCTGCCTCGCCTGGCTGCTCTTAAAAAGGAATGGGATCCCTCCAATG
TGTTTGCCTATAATAATCCGTTGCCTACACAGTACCAAGACGCCCAGCGTTTTTTGACGCCGTCTCTGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail