Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3349
Gene name
LocationContig_251:5992..7066
Strand-
Gene length (bp)1074
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 1.8E-38 35 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08235|BRX1_YEAST Ribosome biogenesis protein BRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRX1 PE=1 SV=2 1 293 8.0E-115
sp|Q9HGL6|BRX1_SCHPO Ribosome biogenesis protein brx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brx1 PE=3 SV=1 1 291 3.0E-104
sp|Q8UVY2|BRX1_XENLA Ribosome biogenesis protein BRX1 homolog OS=Xenopus laevis GN=brix1 PE=2 SV=1 1 292 2.0E-84
sp|Q9DCA5|BRX1_MOUSE Ribosome biogenesis protein BRX1 homolog OS=Mus musculus GN=Brix1 PE=1 SV=3 2 291 8.0E-83
sp|Q3SZZ0|BRX1_BOVIN Ribosome biogenesis protein BRX1 homolog OS=Bos taurus GN=BRIX1 PE=2 SV=1 15 291 3.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08235|BRX1_YEAST Ribosome biogenesis protein BRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRX1 PE=1 SV=2 1 293 8.0E-115
sp|Q9HGL6|BRX1_SCHPO Ribosome biogenesis protein brx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brx1 PE=3 SV=1 1 291 3.0E-104
sp|Q8UVY2|BRX1_XENLA Ribosome biogenesis protein BRX1 homolog OS=Xenopus laevis GN=brix1 PE=2 SV=1 1 292 2.0E-84
sp|Q9DCA5|BRX1_MOUSE Ribosome biogenesis protein BRX1 homolog OS=Mus musculus GN=Brix1 PE=1 SV=3 2 291 8.0E-83
sp|Q3SZZ0|BRX1_BOVIN Ribosome biogenesis protein BRX1 homolog OS=Bos taurus GN=BRIX1 PE=2 SV=1 15 291 3.0E-82
sp|Q8TDN6|BRX1_HUMAN Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens GN=BRIX1 PE=1 SV=2 15 291 4.0E-82
sp|Q5RAN2|BRX1_PONAB Ribosome biogenesis protein BRX1 homolog OS=Pongo abelii GN=BRIX1 PE=2 SV=1 15 291 7.0E-81
sp|Q4QQT6|BRX1_RAT Ribosome biogenesis protein BRX1 homolog OS=Rattus norvegicus GN=Brix1 PE=2 SV=1 15 292 1.0E-80
sp|Q9VZE6|BRX1_DROME Ribosome biogenesis protein BRX1 homolog OS=Drosophila melanogaster GN=CG11583 PE=2 SV=2 26 284 8.0E-73
sp|P34524|BRX1_CAEEL Ribosome biogenesis protein BRX1 homolog OS=Caenorhabditis elegans GN=K12H4.3 PE=3 SV=1 26 274 2.0E-71
sp|Q54JN0|BRX1_DICDI Ribosome biogenesis protein BRX1 homolog OS=Dictyostelium discoideum GN=bxdc2 PE=3 SV=1 26 279 2.0E-71
[Show less]

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0019843 rRNA binding Yes
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0016072 rRNA metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003723 RNA binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3384
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3349 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2522
Ophiocordyceps camponoti-floridani Ophcf2|04301
Ophiocordyceps camponoti-rufipedis Ophun1|2118
Ophiocordyceps kimflemingae Ophio5|1396
Ophiocordyceps subramaniannii Hirsu2|6325

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3349
MAAVYKSLSKGSSQKIEAPVGGAKKNKQRVLILSSRGVTYRHRHLLNDIASMMPHGRKDAKFDSKSKLGELNELA
ELYNCNNVLFFEARKGKDLYVWLSKVPNGPTVKMHLQNLHTMEELHFTGNCLKGSRPILSFDAAFDKQPHLRVVK
ELFLHTFGVPQGARKSKPFIDHVMGFSVADGKIWVRNYQISEEESLVVKPGSEDAEDGAQRKTNPKSRKGSGDTE
IKLVEIGPRFVLTPIVIQEGSFGGPIIYENREFISPNQLRSDLRRSKASRHGARTEKTISRLSRKEDLGLRSSTY
HQRGSNSELDNRVLFS*
Coding >OphauG2|3349
ATGGCTGCCGTCTACAAGTCCCTGTCAAAGGGCAGCTCACAAAAGATTGAGGCGCCTGTGGGTGGCGCCAAGAAG
AACAAGCAACGAGTGCTAATACTTTCATCGAGAGGTGTTACCTATAGGCATCGACACCTCTTGAATGACATTGCG
TCCATGATGCCACATGGTCGGAAAGATGCCAAATTTGACTCCAAATCGAAGCTTGGTGAACTAAACGAATTAGCT
GAGCTCTACAACTGCAACAACGTCTTATTTTTTGAGGCAAGGAAGGGAAAAGATCTTTATGTTTGGCTTAGCAAA
GTGCCCAACGGACCGACGGTCAAGATGCATCTCCAAAACCTTCACACTATGGAGGAACTTCATTTTACAGGCAAT
TGTCTAAAAGGCTCCAGGCCGATCCTTTCGTTCGACGCGGCCTTTGATAAACAGCCCCACCTCCGCGTCGTCAAG
GAACTCTTCCTGCATACCTTTGGAGTGCCTCAAGGAGCGCGAAAGTCAAAACCATTCATCGATCACGTCATGGGC
TTCAGCGTGGCTGATGGCAAAATTTGGGTACGGAATTACCAGATCAGCGAGGAAGAGAGCTTGGTAGTCAAGCCA
GGATCTGAGGATGCCGAAGATGGCGCACAGAGGAAGACCAACCCCAAGTCTAGAAAAGGGAGTGGTGATACAGAG
ATCAAACTCGTCGAAATTGGACCGCGGTTTGTTCTCACTCCGATAGTGATACAGGAAGGCTCGTTTGGTGGCCCA
ATCATCTACGAGAACCGGGAATTTATATCACCAAACCAGTTAAGGTCTGATTTGCGCCGATCAAAGGCCTCCAGA
CATGGCGCCAGGACGGAAAAGACGATATCAAGGTTGTCTCGAAAGGAAGACTTGGGTCTGAGATCCTCTACCTAC
CACCAACGGGGATCCAACAGCGAGCTTGACAATAGGGTTCTGTTTTCATAA
Transcript >OphauG2|3349
ATGGCTGCCGTCTACAAGTCCCTGTCAAAGGGCAGCTCACAAAAGATTGAGGCGCCTGTGGGTGGCGCCAAGAAG
AACAAGCAACGAGTGCTAATACTTTCATCGAGAGGTGTTACCTATAGGCATCGACACCTCTTGAATGACATTGCG
TCCATGATGCCACATGGTCGGAAAGATGCCAAATTTGACTCCAAATCGAAGCTTGGTGAACTAAACGAATTAGCT
GAGCTCTACAACTGCAACAACGTCTTATTTTTTGAGGCAAGGAAGGGAAAAGATCTTTATGTTTGGCTTAGCAAA
GTGCCCAACGGACCGACGGTCAAGATGCATCTCCAAAACCTTCACACTATGGAGGAACTTCATTTTACAGGCAAT
TGTCTAAAAGGCTCCAGGCCGATCCTTTCGTTCGACGCGGCCTTTGATAAACAGCCCCACCTCCGCGTCGTCAAG
GAACTCTTCCTGCATACCTTTGGAGTGCCTCAAGGAGCGCGAAAGTCAAAACCATTCATCGATCACGTCATGGGC
TTCAGCGTGGCTGATGGCAAAATTTGGGTACGGAATTACCAGATCAGCGAGGAAGAGAGCTTGGTAGTCAAGCCA
GGATCTGAGGATGCCGAAGATGGCGCACAGAGGAAGACCAACCCCAAGTCTAGAAAAGGGAGTGGTGATACAGAG
ATCAAACTCGTCGAAATTGGACCGCGGTTTGTTCTCACTCCGATAGTGATACAGGAAGGCTCGTTTGGTGGCCCA
ATCATCTACGAGAACCGGGAATTTATATCACCAAACCAGTTAAGGTCTGATTTGCGCCGATCAAAGGCCTCCAGA
CATGGCGCCAGGACGGAAAAGACGATATCAAGGTTGTCTCGAAAGGAAGACTTGGGTCTGAGATCCTCTACCTAC
CACCAACGGGGATCCAACAGCGAGCTTGACAATAGGGTTCTGTTTTCATAA
Gene >OphauG2|3349
ATGGCTGCCGTCTACAAGTCCCTGTCAAAGGGCAGCTCACAAAAGATTGAGGCGCCTGTGGGTGGCGCCAAGAAG
AACAAGCAACGAGTGCTAATACTTTCATCGAGAGGTGTTACCTATAGGTGAGTCATGGAAGTACAAATATCCTCC
TTTTGCAATACAAGTATTTATTAACATTGTCTGCCAATTCCAGGCATCGACACCTCTTGAATGACATTGCGTCCA
TGATGCCACATGGTCGGAAAGATGCCAAATTTGACTCCAAATCGAAGCTTGGTGAACTAAACGAATTAGCTGAGC
TCTACAACTGCAACAACGTCTTATTTTTTGAGGCAAGGAAGGGAAAAGATCTTTATGTTTGGCTTAGCAAAGTGC
CCAACGGACCGACGGTCAAGATGCATCTCCAAAACCGTAAGCGACAAGATTTATTTGCCATGTTACCAGTTTCTA
ACGACATCTGTAGTTCACACTATGGAGGAACTTCATTTTACAGGCAATTGTCTAAAAGGCTCCAGGCCGATCCTT
TCGTTCGACGCGGCCTTTGATAAACAGCCCCACCTCCGCGTCGTCAAGGAACTCTTCCTGCATACCTTTGGAGTG
CCTCAAGGAGCGCGAAAGTCAAAACCATTCATCGATCACGTCATGGGCTTCAGCGTGGCTGATGGCAAAATTTGG
GTACGGAATTACCAGATCAGCGAGGAAGAGAGCTTGGTAGTCAAGCCAGGATCTGAGGATGCCGAAGATGGCGCA
CAGAGGAAGACCAACCCCAAGTCTAGAAAAGGGAGTGGTGATACAGAGATCAAACTCGTCGAAATTGGACCGCGG
TTTGTTCTCACTCCGATAGTGATACAGGAAGGCTCGTTTGGTGGCCCAATCATCTACGAGAACCGGGAATTTATA
TCACCAAACCAGTTAAGGTCTGATTTGCGCCGATCAAAGGCCTCCAGACATGGCGCCAGGACGGAAAAGACGATA
TCAAGGTTGTCTCGAAAGGAAGACTTGGGTCTGAGATCCTCTACCTACCACCAACGGGGATCCAACAGCGAGCTT
GACAATAGGGTTCTGTTTTCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail