Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3347
Gene name
LocationContig_251:516..2973
Strand-
Gene length (bp)2457
Transcript length (bp)2205
Coding sequence length (bp)2205
Protein length (aa) 735

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09757 Arb2 Arb2 domain 5.9E-97 463 720
PF00850 Hist_deacetyl Histone deacetylase domain 2.0E-82 85 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56523|CLR3_SCHPO Histone deacetylase clr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr3 PE=1 SV=1 31 716 3.0E-168
sp|P53973|HDA1_YEAST Histone deacetylase HDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HDA1 PE=1 SV=1 61 716 4.0E-155
sp|Q5A960|HDA1_CANAL Histone deacetylase HDA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HDA1 PE=1 SV=1 38 727 5.0E-138
sp|Q9Z2V5|HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=3 63 447 3.0E-83
sp|Q9UBN7|HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2 63 447 5.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56523|CLR3_SCHPO Histone deacetylase clr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr3 PE=1 SV=1 31 716 3.0E-168
sp|P53973|HDA1_YEAST Histone deacetylase HDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HDA1 PE=1 SV=1 61 716 4.0E-155
sp|Q5A960|HDA1_CANAL Histone deacetylase HDA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HDA1 PE=1 SV=1 38 727 5.0E-138
sp|Q9Z2V5|HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=3 63 447 3.0E-83
sp|Q9UBN7|HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2 63 447 5.0E-78
sp|Q6P3E7|HDA10_MOUSE Histone deacetylase 10 OS=Mus musculus GN=Hdac10 PE=2 SV=2 128 453 9.0E-76
sp|Q8LRK8|HDA18_ARATH Histone deacetylase 18 OS=Arabidopsis thaliana GN=HDA18 PE=2 SV=1 50 490 8.0E-74
sp|Q99P99|HDAC4_RAT Histone deacetylase 4 OS=Rattus norvegicus GN=Hdac4 PE=1 SV=2 37 447 3.0E-73
sp|Q8RX28|HDA5_ARATH Histone deacetylase 5 OS=Arabidopsis thaliana GN=HDA5 PE=1 SV=1 50 446 4.0E-73
sp|P56524|HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens GN=HDAC4 PE=1 SV=3 37 447 2.0E-72
sp|Q6NZM9|HDAC4_MOUSE Histone deacetylase 4 OS=Mus musculus GN=Hdac4 PE=1 SV=1 37 447 3.0E-72
sp|Q969S8|HDA10_HUMAN Histone deacetylase 10 OS=Homo sapiens GN=HDAC10 PE=1 SV=1 111 447 2.0E-71
sp|Q80ZH1|HDAC5_CRIGR Histone deacetylase 5 OS=Cricetulus griseus GN=HDAC5 PE=2 SV=1 38 447 3.0E-71
sp|P83038|HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus GN=HDAC4 PE=2 SV=1 37 447 8.0E-70
sp|Q9UBN7|HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2 86 446 1.0E-69
sp|Q9Z2V5|HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=3 43 450 1.0E-69
sp|Q8WUI4|HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens GN=HDAC7 PE=1 SV=2 2 447 2.0E-69
sp|Q8GXJ1|HDA15_ARATH Histone deacetylase 15 OS=Arabidopsis thaliana GN=HDA15 PE=2 SV=2 67 424 6.0E-69
sp|Q8C2B3|HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus GN=Hdac7 PE=1 SV=2 63 447 2.0E-68
sp|Q9UKV0|HDAC9_HUMAN Histone deacetylase 9 OS=Homo sapiens GN=HDAC9 PE=1 SV=2 6 413 4.0E-67
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 84 447 6.0E-66
sp|Q9Z2V6|HDAC5_MOUSE Histone deacetylase 5 OS=Mus musculus GN=Hdac5 PE=1 SV=2 60 447 3.0E-65
sp|Q613L4|HDA4_CAEBR Histone deacetylase 4 OS=Caenorhabditis briggsae GN=hda-4 PE=3 SV=1 63 446 4.0E-65
sp|Q9UQL6|HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens GN=HDAC5 PE=1 SV=2 38 447 2.0E-64
sp|O17323|HDA4_CAEEL Histone deacetylase 4 OS=Caenorhabditis elegans GN=hda-4 PE=1 SV=3 63 446 5.0E-64
sp|Q5R902|HDAC5_PONAB Histone deacetylase 5 OS=Pongo abelii GN=HDAC5 PE=2 SV=1 38 447 8.0E-64
sp|Q569C4|HDA10_RAT Histone deacetylase 10 OS=Rattus norvegicus GN=Hdac10 PE=2 SV=1 133 426 7.0E-58
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 50 446 3.0E-50
sp|Q70I53|HDAH_ALCSD Histone deacetylase-like amidohydrolase OS=Alcaligenes sp. (strain DSM 11172) GN=hdaH PE=1 SV=3 75 413 4.0E-43
sp|Q941D6|HDA14_ARATH Histone deacetylase 14 OS=Arabidopsis thaliana GN=HDA14 PE=2 SV=1 131 414 7.0E-41
sp|O30107|Y130_ARCFU Uncharacterized protein AF_0130 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0130 PE=3 SV=1 182 447 2.0E-40
sp|O27262|Y1194_METTH Uncharacterized protein MTH_1194 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1194 PE=3 SV=1 137 414 3.0E-36
sp|P72702|Y245_SYNY3 Uncharacterized protein slr0245 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0245 PE=3 SV=1 85 412 2.0E-32
sp|Q94EJ2|HDA8_ARATH Histone deacetylase 8 OS=Arabidopsis thaliana GN=HDA8 PE=2 SV=1 148 437 3.0E-30
sp|Q57955|Y535_METJA Uncharacterized protein MJ0535 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0535 PE=3 SV=1 81 397 2.0E-29
sp|Q54VQ7|HDA22_DICDI Type-2 histone deacetylase 2 OS=Dictyostelium discoideum GN=hdaC PE=2 SV=1 176 398 5.0E-26
sp|Q3JUN4|APHA_BURP1 Acetylpolyamine aminohydrolase OS=Burkholderia pseudomallei (strain 1710b) GN=aphA PE=1 SV=1 207 404 4.0E-23
sp|O13298|PHD1_SCHPO Histone deacetylase phd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phd1 PE=1 SV=1 125 403 3.0E-22
sp|P53096|HOS2_YEAST Probable histone deacetylase HOS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS2 PE=1 SV=1 53 366 1.0E-21
sp|Q56195|ACUC_STAXY Acetoin utilization protein AcuC OS=Staphylococcus xylosus GN=acuC PE=3 SV=1 128 448 4.0E-21
sp|P39067|ACUC_BACSU Acetoin utilization protein AcuC OS=Bacillus subtilis (strain 168) GN=acuC PE=3 SV=1 128 422 7.0E-21
sp|P32561|RPD3_YEAST Histone deacetylase RPD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPD3 PE=1 SV=1 77 403 4.0E-20
sp|P56517|HDAC1_CHICK Histone deacetylase 1 OS=Gallus gallus GN=HDAC1 PE=2 SV=1 85 416 2.0E-19
sp|Q48935|APHA_MYCRA Acetylpolyamine aminohydrolase OS=Mycoplana ramosa GN=aphA PE=1 SV=1 181 413 7.0E-19
sp|Q91695|HDA1A_XENLA Probable histone deacetylase 1-A OS=Xenopus laevis GN=hdac1-a PE=1 SV=1 85 366 3.0E-18
sp|O09106|HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus GN=Hdac1 PE=1 SV=1 85 416 3.0E-18
sp|Q4QQW4|HDAC1_RAT Histone deacetylase 1 OS=Rattus norvegicus GN=Hdac1 PE=1 SV=1 85 416 3.0E-18
sp|Q5RAG0|HDAC1_PONAB Histone deacetylase 1 OS=Pongo abelii GN=HDAC1 PE=2 SV=1 85 416 4.0E-18
sp|Q32PJ8|HDAC1_BOVIN Histone deacetylase 1 OS=Bos taurus GN=HDAC1 PE=2 SV=1 85 416 4.0E-18
sp|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens GN=HDAC1 PE=1 SV=1 85 416 4.0E-18
sp|O42227|HDA1B_XENLA Probable histone deacetylase 1-B OS=Xenopus laevis GN=hdac1-b PE=1 SV=1 85 416 7.0E-18
sp|Q94517|HDAC1_DROME Histone deacetylase Rpd3 OS=Drosophila melanogaster GN=Rpd3 PE=1 SV=2 85 366 9.0E-18
sp|Q09440|HDA2_CAEEL Putative histone deacetylase 2 OS=Caenorhabditis elegans GN=hda-2 PE=3 SV=1 123 413 9.0E-18
sp|Q55FN5|HDA11_DICDI Type-1 histone deacetylase 1 OS=Dictyostelium discoideum GN=hdaA PE=2 SV=1 131 416 1.0E-17
sp|Q92769|HDAC2_HUMAN Histone deacetylase 2 OS=Homo sapiens GN=HDAC2 PE=1 SV=2 123 366 2.0E-17
sp|P70288|HDAC2_MOUSE Histone deacetylase 2 OS=Mus musculus GN=Hdac2 PE=1 SV=1 123 366 2.0E-17
sp|O59702|CLR6_SCHPO Histone deacetylase clr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr6 PE=1 SV=1 128 366 2.0E-17
sp|P56521|HDA19_MAIZE Probable histone deacetylase 19 OS=Zea mays PE=2 SV=1 85 366 3.0E-17
sp|Q54X15|HDA21_DICDI Type-2 histone deacetylase 1 OS=Dictyostelium discoideum GN=hdaD PE=2 SV=1 85 288 3.0E-17
sp|O17695|HDA1_CAEEL Histone deacetylase 1 OS=Caenorhabditis elegans GN=hda-1 PE=1 SV=1 133 416 8.0E-17
sp|Q55BW2|HDA12_DICDI Histone deacetylase B OS=Dictyostelium discoideum GN=hdaB PE=2 SV=1 125 416 1.0E-16
sp|O22446|HDA19_ARATH Histone deacetylase 19 OS=Arabidopsis thaliana GN=HDA19 PE=1 SV=2 85 366 2.0E-16
sp|P56518|HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus GN=HDAC1 PE=2 SV=1 123 366 4.0E-16
sp|Q8NW34|ACUC_STAAW Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain MW2) GN=acuC PE=3 SV=1 128 434 6.0E-16
sp|Q6G8J2|ACUC_STAAS Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain MSSA476) GN=acuC PE=3 SV=1 128 434 6.0E-16
sp|Q9FML2|HDA6_ARATH Histone deacetylase 6 OS=Arabidopsis thaliana GN=HDA6 PE=1 SV=1 191 408 8.0E-16
sp|Q5HF39|ACUC_STAAC Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain COL) GN=acuC PE=3 SV=1 128 434 1.0E-15
sp|P64376|ACUC_STAAN Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain N315) GN=acuC PE=1 SV=1 128 434 2.0E-15
sp|P64375|ACUC_STAAM Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=acuC PE=3 SV=1 128 434 2.0E-15
sp|Q6GPA7|HDAC8_XENLA Histone deacetylase 8 OS=Xenopus laevis GN=hdac8 PE=2 SV=1 182 416 7.0E-15
sp|Q6GFX3|ACUC_STAAR Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain MRSA252) GN=acuC PE=3 SV=1 128 434 8.0E-15
sp|Q8VH37|HDAC8_MOUSE Histone deacetylase 8 OS=Mus musculus GN=Hdac8 PE=1 SV=2 178 416 1.0E-14
sp|B1WC68|HDAC8_RAT Histone deacetylase 8 OS=Rattus norvegicus GN=Hdac8 PE=2 SV=1 178 416 1.0E-14
sp|Q9BY41|HDAC8_HUMAN Histone deacetylase 8 OS=Homo sapiens GN=HDAC8 PE=1 SV=2 178 416 2.0E-14
sp|B1H369|HDAC8_XENTR Histone deacetylase 8 OS=Xenopus tropicalis GN=hdac8 PE=2 SV=1 123 416 2.0E-14
sp|P56519|HDAC2_CHICK Histone deacetylase 2 OS=Gallus gallus GN=HDAC2 PE=2 SV=1 85 366 2.0E-14
sp|Q02959|HOS3_YEAST Histone deacetylase HOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS3 PE=1 SV=1 175 406 3.0E-14
sp|Q8H0W2|HDA9_ARATH Histone deacetylase 9 OS=Arabidopsis thaliana GN=HDA9 PE=1 SV=1 132 366 7.0E-14
sp|Q7SXM0|HDAC8_DANRE Histone deacetylase 8 OS=Danio rerio GN=hdac8 PE=2 SV=1 123 379 1.0E-13
sp|Q4SFA0|HDAC3_TETNG Histone deacetylase 3 OS=Tetraodon nigroviridis GN=hdac3 PE=3 SV=1 77 366 4.0E-13
sp|Q803C3|HDAC3_DANRE Histone deacetylase 3 OS=Danio rerio GN=hdac3 PE=2 SV=1 77 366 5.0E-13
sp|Q6IRL9|HDAC3_XENLA Histone deacetylase 3 OS=Xenopus laevis GN=hdac3 PE=2 SV=2 133 366 7.0E-13
sp|Q6P6W3|HDAC3_RAT Histone deacetylase 3 OS=Rattus norvegicus GN=Hdac3 PE=1 SV=1 133 366 7.0E-13
sp|O88895|HDAC3_MOUSE Histone deacetylase 3 OS=Mus musculus GN=Hdac3 PE=1 SV=1 133 366 8.0E-13
sp|O15379|HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens GN=HDAC3 PE=1 SV=2 133 366 9.0E-13
sp|P56520|HDAC3_CHICK Histone deacetylase 3 OS=Gallus gallus GN=HDAC3 PE=2 SV=1 133 366 1.0E-12
sp|Q5RB76|HDAC3_PONAB Histone deacetylase 3 OS=Pongo abelii GN=HDAC3 PE=2 SV=1 133 366 1.0E-12
sp|Q96DB2|HDA11_HUMAN Histone deacetylase 11 OS=Homo sapiens GN=HDAC11 PE=1 SV=1 216 395 1.0E-12
sp|Q9GKU5|HDA11_MACFA Histone deacetylase 11 OS=Macaca fascicularis GN=HDAC11 PE=2 SV=2 216 395 2.0E-12
sp|Q28DV3|HDAC3_XENTR Histone deacetylase 3 OS=Xenopus tropicalis GN=hdac3 PE=2 SV=1 133 366 2.0E-12
sp|Q0VCB2|HDAC8_BOVIN Histone deacetylase 8 OS=Bos taurus GN=HDAC8 PE=2 SV=1 178 416 6.0E-12
sp|P28606|Y1628_SYNP2 Uncharacterized protein SYNPCC7002_A1628 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A1628 PE=3 SV=2 185 394 1.0E-11
sp|Q91WA3|HDA11_MOUSE Histone deacetylase 11 OS=Mus musculus GN=Hdac11 PE=1 SV=1 216 395 2.0E-11
sp|Q12214|HOS1_YEAST Histone deacetylase HOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS1 PE=1 SV=1 199 360 6.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2737
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3347 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2520
Ophiocordyceps camponoti-floridani Ophcf2|04300
Ophiocordyceps camponoti-rufipedis Ophun1|2117
Ophiocordyceps kimflemingae Ophio5|1395
Ophiocordyceps subramaniannii Hirsu2|4325

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3347
MNQSVAMDLDNSPMGDVAMANGVDSVESNDLVSVEDPMGDDESEPEAQDLATQQQRRRGLLPTGCCYDDRMKLHM
NADFSPNAHHPEDPRRIHEIFKAFKKMGLIYAGPEADLARIIKECPTRYMWRIAARSATPQEICLAHSADHLAWV
ENLDTLSTAELRELTKQYDQGRESLYVGSMSYPAALLAAGGAIDTCKNVVTGQVKNAFAVIRPPGHHAEWDAPMG
FCFFNNVPVAVRVCQQDYPDICRKVLILDWDVHHGNGIQNIFYQDPNVLYISIHVYLNGSFYPGKPPNPMTPDGG
IENCGSGPGLGKNINIGWHDQGMGDGEYMAAFQKIVMPIAQEFGPDLVVISAGFDAAQGDLLGGCFVTPACYAHM
THMLMSLADGKVAVCLEGGYSLEAISNSAVAVAKTLMGEPPPMMDIPKINKEAARILAKVQAHQAPYWECMRPGI
VDVPQVQSQNAHRLHDFIRNAQRQILQEKHNMIPLYVQREILNKSFENQVLVTPQLQSAKRILIILHDPPQLLAQ
PDVLDTSIEAHNAWVVDGVTQYIDWACREKFGVMDINVPCYISQEDDSDAYTPGYNEQAIQQQIQQVMCYLWDNF
IQLYETDEIFLISAGNAYLGVKMLLVSRDCRAKLSGVVNFVTGTLRTVKSDIDTELSSWYKENSRVYVAADHACW
ADPALTRKVHKKRFGTVVHSNMVGLNQMMREHAAEAQDWIMARVTSGDTTEEEEKGHVS*
Coding >OphauG2|3347
ATGAATCAGAGCGTGGCCATGGATTTGGACAATTCGCCCATGGGAGACGTCGCCATGGCCAACGGAGTCGACAGT
GTCGAGTCCAACGACTTGGTCTCGGTTGAGGATCCCATGGGCGACGACGAGAGCGAGCCTGAAGCCCAGGACTTG
GCAACGCAGCAGCAGCGTCGCCGCGGCCTTCTCCCTACCGGCTGCTGCTATGACGATCGCATGAAGCTTCACATG
AATGCAGACTTTAGTCCCAACGCTCACCATCCAGAGGATCCTCGCCGCATTCACGAGATCTTCAAGGCCTTCAAG
AAGATGGGCCTCATCTACGCGGGCCCCGAGGCTGACCTTGCTCGCATCATCAAGGAGTGTCCGACGCGTTACATG
TGGAGAATTGCCGCGCGCTCGGCCACGCCCCAGGAGATTTGCCTTGCTCACTCGGCGGACCATCTGGCATGGGTC
GAGAACTTGGACACGCTCAGCACGGCCGAGCTTCGCGAGCTCACCAAGCAGTATGATCAGGGCCGCGAGTCGCTG
TACGTGGGCAGCATGTCATATCCTGCTGCCCTGCTTGCGGCCGGCGGCGCCATCGACACGTGCAAGAATGTCGTC
ACGGGCCAGGTCAAGAATGCCTTTGCTGTCATTCGCCCACCCGGCCATCATGCCGAGTGGGACGCCCCCATGGGT
TTTTGCTTTTTCAACAACGTGCCTGTTGCTGTGCGTGTCTGTCAACAAGACTATCCCGATATCTGTCGCAAGGTT
CTCATTCTCGACTGGGATGTTCACCACGGCAATGGCATCCAAAACATTTTTTACCAGGATCCCAATGTTCTCTAC
ATTTCTATCCATGTATACTTAAACGGCTCCTTTTACCCTGGCAAGCCTCCCAATCCCATGACACCCGACGGCGGT
ATTGAAAACTGTGGCTCTGGCCCCGGCTTGGGCAAGAATATCAATATCGGCTGGCACGACCAGGGCATGGGCGAT
GGTGAGTACATGGCGGCATTCCAGAAAATTGTCATGCCCATAGCCCAGGAGTTCGGGCCCGACTTGGTAGTCATC
TCAGCTGGCTTCGATGCTGCCCAGGGTGATCTCTTGGGCGGCTGCTTCGTGACTCCAGCCTGCTACGCCCACATG
ACGCATATGCTCATGTCTCTGGCTGACGGAAAAGTCGCCGTCTGTCTTGAAGGCGGCTACAGTCTCGAGGCCATA
TCAAACTCGGCTGTAGCTGTTGCAAAGACTCTGATGGGTGAACCGCCGCCCATGATGGATATTCCCAAGATTAAC
AAGGAGGCTGCCAGGATTCTAGCCAAGGTCCAGGCCCATCAAGCGCCTTATTGGGAATGCATGCGTCCGGGAATC
GTCGATGTGCCTCAGGTGCAGTCACAAAATGCTCACCGTCTGCATGACTTCATTAGGAATGCGCAGCGCCAGATT
CTGCAGGAAAAACACAACATGATACCGCTTTATGTGCAAAGAGAAATATTGAACAAGTCGTTTGAGAACCAGGTT
CTAGTGACGCCTCAGCTTCAGTCTGCCAAGAGGATACTCATTATTCTGCATGACCCACCGCAGCTTCTCGCTCAG
CCAGACGTACTTGATACGTCTATAGAAGCGCATAATGCCTGGGTGGTCGATGGTGTGACTCAATACATTGACTGG
GCTTGCCGTGAAAAGTTTGGTGTCATGGATATCAATGTGCCCTGCTATATCTCGCAGGAAGATGATTCGGATGCC
TATACTCCCGGCTATAATGAGCAGGCTATACAACAGCAAATACAGCAAGTCATGTGTTATTTGTGGGACAACTTT
ATACAGCTGTACGAGACGGACGAGATATTTCTCATTAGTGCCGGCAATGCCTATTTGGGAGTCAAGATGCTTCTT
GTGAGCCGAGACTGCAGAGCCAAGTTGTCTGGAGTGGTGAATTTCGTGACAGGGACCCTTCGGACCGTCAAGTCA
GACATTGACACGGAGCTCTCGTCATGGTACAAGGAGAACTCCCGGGTATATGTGGCCGCCGATCATGCATGCTGG
GCCGACCCTGCGTTGACGAGAAAGGTGCACAAGAAGCGATTTGGCACCGTGGTGCATAGCAACATGGTGGGACTC
AATCAGATGATGAGAGAGCATGCTGCAGAGGCACAGGATTGGATAATGGCACGCGTCACATCGGGAGACACGACC
GAGGAAGAGGAAAAGGGACATGTGTCGTGA
Transcript >OphauG2|3347
ATGAATCAGAGCGTGGCCATGGATTTGGACAATTCGCCCATGGGAGACGTCGCCATGGCCAACGGAGTCGACAGT
GTCGAGTCCAACGACTTGGTCTCGGTTGAGGATCCCATGGGCGACGACGAGAGCGAGCCTGAAGCCCAGGACTTG
GCAACGCAGCAGCAGCGTCGCCGCGGCCTTCTCCCTACCGGCTGCTGCTATGACGATCGCATGAAGCTTCACATG
AATGCAGACTTTAGTCCCAACGCTCACCATCCAGAGGATCCTCGCCGCATTCACGAGATCTTCAAGGCCTTCAAG
AAGATGGGCCTCATCTACGCGGGCCCCGAGGCTGACCTTGCTCGCATCATCAAGGAGTGTCCGACGCGTTACATG
TGGAGAATTGCCGCGCGCTCGGCCACGCCCCAGGAGATTTGCCTTGCTCACTCGGCGGACCATCTGGCATGGGTC
GAGAACTTGGACACGCTCAGCACGGCCGAGCTTCGCGAGCTCACCAAGCAGTATGATCAGGGCCGCGAGTCGCTG
TACGTGGGCAGCATGTCATATCCTGCTGCCCTGCTTGCGGCCGGCGGCGCCATCGACACGTGCAAGAATGTCGTC
ACGGGCCAGGTCAAGAATGCCTTTGCTGTCATTCGCCCACCCGGCCATCATGCCGAGTGGGACGCCCCCATGGGT
TTTTGCTTTTTCAACAACGTGCCTGTTGCTGTGCGTGTCTGTCAACAAGACTATCCCGATATCTGTCGCAAGGTT
CTCATTCTCGACTGGGATGTTCACCACGGCAATGGCATCCAAAACATTTTTTACCAGGATCCCAATGTTCTCTAC
ATTTCTATCCATGTATACTTAAACGGCTCCTTTTACCCTGGCAAGCCTCCCAATCCCATGACACCCGACGGCGGT
ATTGAAAACTGTGGCTCTGGCCCCGGCTTGGGCAAGAATATCAATATCGGCTGGCACGACCAGGGCATGGGCGAT
GGTGAGTACATGGCGGCATTCCAGAAAATTGTCATGCCCATAGCCCAGGAGTTCGGGCCCGACTTGGTAGTCATC
TCAGCTGGCTTCGATGCTGCCCAGGGTGATCTCTTGGGCGGCTGCTTCGTGACTCCAGCCTGCTACGCCCACATG
ACGCATATGCTCATGTCTCTGGCTGACGGAAAAGTCGCCGTCTGTCTTGAAGGCGGCTACAGTCTCGAGGCCATA
TCAAACTCGGCTGTAGCTGTTGCAAAGACTCTGATGGGTGAACCGCCGCCCATGATGGATATTCCCAAGATTAAC
AAGGAGGCTGCCAGGATTCTAGCCAAGGTCCAGGCCCATCAAGCGCCTTATTGGGAATGCATGCGTCCGGGAATC
GTCGATGTGCCTCAGGTGCAGTCACAAAATGCTCACCGTCTGCATGACTTCATTAGGAATGCGCAGCGCCAGATT
CTGCAGGAAAAACACAACATGATACCGCTTTATGTGCAAAGAGAAATATTGAACAAGTCGTTTGAGAACCAGGTT
CTAGTGACGCCTCAGCTTCAGTCTGCCAAGAGGATACTCATTATTCTGCATGACCCACCGCAGCTTCTCGCTCAG
CCAGACGTACTTGATACGTCTATAGAAGCGCATAATGCCTGGGTGGTCGATGGTGTGACTCAATACATTGACTGG
GCTTGCCGTGAAAAGTTTGGTGTCATGGATATCAATGTGCCCTGCTATATCTCGCAGGAAGATGATTCGGATGCC
TATACTCCCGGCTATAATGAGCAGGCTATACAACAGCAAATACAGCAAGTCATGTGTTATTTGTGGGACAACTTT
ATACAGCTGTACGAGACGGACGAGATATTTCTCATTAGTGCCGGCAATGCCTATTTGGGAGTCAAGATGCTTCTT
GTGAGCCGAGACTGCAGAGCCAAGTTGTCTGGAGTGGTGAATTTCGTGACAGGGACCCTTCGGACCGTCAAGTCA
GACATTGACACGGAGCTCTCGTCATGGTACAAGGAGAACTCCCGGGTATATGTGGCCGCCGATCATGCATGCTGG
GCCGACCCTGCGTTGACGAGAAAGGTGCACAAGAAGCGATTTGGCACCGTGGTGCATAGCAACATGGTGGGACTC
AATCAGATGATGAGAGAGCATGCTGCAGAGGCACAGGATTGGATAATGGCACGCGTCACATCGGGAGACACGACC
GAGGAAGAGGAAAAGGGACATGTGTCGTGA
Gene >OphauG2|3347
ATGAATCAGAGCGTGGCCATGGATTTGGACAATTCGCCCATGGGAGACGTCGCCATGGCCAACGGAGTCGACAGT
GTCGAGTCCAACGACTTGGTCTCGGTTGAGGATCCCATGGGCGACGACGAGAGCGAGCCTGAAGCCCAGGACTTG
GCAACGCAGCAGCAGCGTCGCCGCGGCCTTCTCCCTACCGGCTGCTGCTATGACGATCGCATGAAGCTTCACATG
AATGCAGACTTTAGTCCCAACGCTCACCATCCAGAGGATCCTCGCCGCATTCACGAGATCTTCAAGGCCTTCAAG
AAGATGGGCCTCATCTACGCGGGCCCCGAGGCTGACCTTGCTCGCATCATCAAGGAGTGTCCGACGCGTTACATG
TGGAGAATTGCCGCGCGCTCGGCCACGCCCCAGGAGATTTGCCTTGCTCACTCGGCGGACCATCTGGCATGGGTC
GAGAACTTGGACACGCTCAGCACGGCCGAGCTTCGCGAGCTCACCAAGCAGTATGATCAGGGCCGCGAGTCGCTG
TACGTGGGCAGCATGTCATATCCTGCTGCCCTGCTTGCGGCCGGCGGCGCCATCGACACGTGCAAGAATGTCGTC
ACGGGCCAGGTCAAGAATGCCTTTGCTGTCATTCGCCCACCCGGCCATCATGCCGAGTGGGACGCCCCCATGGGT
TTTTGCTTTTTCAACAACGTGCCTGTTGCTGTGCGTGTCTGTCAACAAGACTATCCCGATATCTGTCGCAAGGTT
CTCATTCTCGACTGGGATGTTCACCACGGCAATGGCATCCAAAACATTTTTTACCAGGATCCCAATGTTCTCTAC
ATTTCTATCCATGTATACTTAAACGGCTCCTTTTACCCTGGCAAGCCTCCCAATCCCATGACACCCGACGGCGGT
ATTGAAAACTGTGGCTCTGGCCCCGGCTTGGGCAAGAATATCAATATCGGCTGGCACGACCAGGGCATGGGCGAT
GGTGAGTACATGGCGGCATTCCAGAAAATTGTCATGCCCATAGCCCAGGAGTTCGGGCCCGACTTGGTAGTCATC
TCAGCTGGCTTCGATGCTGCCCAGGGTGATCTCTTGGGCGGCTGCTTCGTGACTCCAGCCTGCTACGCCCACATG
ACGCATATGCTCATGTCTCTGGCTGACGGAAAAGTCGCCGTCTGTCTTGAAGGCGGCTACAGTCTCGAGGCCATA
TCAAACTCGGCTGTAGCTGTTGCAAAGACTCTGATGGGTGAACCGCCGCCCATGATGGATATTCCCAAGATTAAC
AAGGAGGCTGCCAGGATTCTAGCCAAGGTCCAGGCCCATCAAGCGCCTTATTGGGAATGCATGCGTCCGGGAATC
GTCGATGTGCCTCAGGTGCAGTCACAAAATGCTCACCGTCTGCATGACTTCATTAGGAATGCGCAGCGCCAGATT
CTGCAGGAAAAACACAACATGATACCGCTTTATGTGCAAAGAGAAATATTGAACAAGTCGTTTGAGAACCAGGTT
CTAGTGACGCCTCAGCTTCAGTCTGCCAAGAGGATACTCATTATTCTGCATGACCCGTAAGTCAAAAAAAAAAAA
AGACGAAAGACGAGCATTCTGTTTCTTCAACAGCTAATCACCCTGGCAGACCGCAGCTTCTCGCTCAGCCAGACG
TACTTGATACGTCTATAGAAGCGCATAATGCCTGGGTGGTATGAACCATCTAACAAGAGCATGGCTCAAGTCTTT
GCGCGTGTAGCTGACGATGAGTAGGTCGATGGTGTGACTCAATACATTGACTGGGCTTGCCGTGAAAAGTTTGGT
GTCATGGATATCAATGTGCCCTGCTATATCTCGCAGGAAGATGTCAGAAACCTCAGGAACCCTTACCTCAGAGAA
GGACCTGTCTATTCTGACATGAACATGCAGGATTCGGATGCCTATACTCCCGGCTATAATGAGCAGGCTATACAA
CAGCAAATACAGCAAGTCATGTGTTATTTGTGGGACAACTTTATACAGCTGTACGAGACGGACGAGATATTTCTC
ATTAGTGCCGGCAATGCCTATTTGGGAGTCAAGATGCTTCTTGTGAGCCGAGGTGAGTTGAGCTCTTTGTGACAG
ACGCATAGCACGGATGGGTACTGACTTTTAGCTGCAGACTGCAGAGCCAAGTTGTCTGGAGTGGTGAATTTCGTG
ACAGGGACCCTTCGGACCGTCAAGTCAGACATTGACACGGAGCTCTCGTCATGGTACAAGGAGAACTCCCGGGTA
TATGTGGCCGCCGATCATGCATGCTGGGCCGACCCTGCGTTGACGAGAAAGGTGCACAAGAAGCGATTTGGCACC
GTGGTGCATAGCAACATGGTGGGACTCAATCAGATGATGAGAGAGCATGCTGCAGAGGCACAGGATTGGATAATG
GCACGCGTCACATCGGGAGACACGACCGAGGAAGAGGAAAAGGGACATGTGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail