Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3345
Gene name
LocationContig_250:13838..16324
Strand+
Gene length (bp)2486
Transcript length (bp)2418
Coding sequence length (bp)2418
Protein length (aa) 806

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 5.8E-31 411 531
PF10405 BHD_3 Rad4 beta-hairpin domain 3 1.3E-27 660 732
PF10403 BHD_1 Rad4 beta-hairpin domain 1 1.0E-20 537 593
PF10404 BHD_2 Rad4 beta-hairpin domain 2 6.7E-15 597 653

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 157 771 6.0E-90
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 422 804 5.0E-54
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 422 770 4.0E-51
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 426 770 3.0E-40
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 423 770 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 157 771 6.0E-90
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 422 804 5.0E-54
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 422 770 4.0E-51
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 426 770 3.0E-40
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 423 770 3.0E-38
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 426 770 1.0E-37
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 426 770 2.0E-36
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 96 326 5.0E-16
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 176 330 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3812
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3345 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7020
Ophiocordyceps camponoti-floridani Ophcf2|01135
Ophiocordyceps camponoti-rufipedis Ophun1|3928
Ophiocordyceps kimflemingae Ophio5|2498
Ophiocordyceps subramaniannii Hirsu2|7460

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3345
MVRSRRPRNAADEGNIYQQMLAEAGVSTWARDSPARPLKRRRGGPHTPSIISPDPHVGKHDDTASSSDKADDKAD
DKADDSHDDDDESIEFEDVPLPRPTLQTLERDSDDEPDDQQDQDLLHLDKVPLPRLSDATPIHRGAALLQLNLSA
QQQSATSVKRGAQRRKPLTKEERMRRIDLHKAHLVCLLAHVARRNHWCNDVEAQERLVQLLDEKTASSLNPQRHL
AQFTQTEKLKLGLRQTLNLWKNKYAVTEKGLDRASCPRHADVLKDCEPPRAMDSCFDRASFREAAKKLQGSRDLG
AQLYCALLRAVGVRARLVCSLQPLAFFSGAQGQDEREYEGAPPVSSRAAKAQEAVSKYQGLAGKVNATSSIPTSS
ARAASRSAALSRLGNARAPVAKPNPCTSPPTLRHQLDRPGELNKSSFPVYWVEVLDTGHQKWQPVDAVVLGSMWN
TKAFDPPITDKANYLSYVVAFEADGRAKDVTRRYAKAYTAKTRKLRVESATDDGQMWWEGVMKFFKAKRPSDLDQ
IEDGELASAEAREPMPRNLQDFKKHPVYALERHLRRNEVLVEGATVCGTVGATGSRGVLDKIYRRKDVRIARSAD
KWYRLGRQVKANEIAAKWLPSKRRDNGEDGVDDGGGGGTPIYTIDQTELFQAPPVLNGQVPKNKFGNVDLYVDSM
LPRGGVHIRGQDASRAAFLLGIDYAPALTGFQFQGRHGTAVLDGVVVAAEYVEAVEAVIAGLEQLKEEASREIRM
AQVLGKWRRLMVGLRIRERIWSGVDAAERQEAERCQMDDDNDDNDDYGGGGWLPE*
Coding >OphauG2|3345
ATGGTTAGAAGCCGACGGCCCAGAAACGCCGCTGACGAGGGCAACATCTACCAGCAGATGCTGGCCGAGGCAGGC
GTCTCTACATGGGCAAGGGACTCTCCAGCTCGCCCGTTGAAAAGGAGGCGAGGTGGGCCGCATACACCCTCCATC
ATTTCTCCAGACCCCCACGTTGGGAAGCATGACGACACGGCCAGTAGCAGCGACAAGGCCGACGACAAGGCCGAC
GACAAGGCCGACGACAGCCACGACGACGACGACGAATCCATCGAGTTTGAAGATGTCCCTTTGCCCCGGCCAACG
CTTCAGACTCTGGAGCGAGACTCGGACGACGAGCCAGACGACCAGCAAGACCAAGATCTGCTGCACCTTGACAAG
GTGCCGTTGCCTCGGCTCAGCGATGCAACGCCGATCCATCGTGGTGCCGCACTGTTGCAACTCAACCTGTCCGCT
CAGCAGCAATCTGCAACCTCGGTCAAAAGGGGCGCTCAGAGACGCAAGCCACTCACCAAGGAGGAGCGGATGCGA
CGTATCGACCTGCACAAGGCACATCTTGTGTGCCTGCTTGCGCACGTCGCCCGAAGAAACCACTGGTGCAACGAT
GTCGAGGCACAAGAGCGCCTTGTCCAGCTCCTGGATGAAAAAACAGCTTCGAGTCTCAATCCTCAAAGACACTTG
GCCCAATTTACACAAACTGAAAAATTGAAGCTTGGCCTGAGACAGACTTTGAATCTGTGGAAAAACAAGTATGCC
GTCACGGAGAAAGGCCTTGATAGAGCGTCATGCCCTCGACATGCCGACGTGCTCAAGGACTGTGAGCCCCCACGC
GCCATGGATTCTTGCTTTGATCGTGCCAGCTTTCGCGAGGCGGCCAAGAAGCTACAAGGATCTCGTGACTTGGGC
GCACAGCTATACTGTGCCTTGCTTCGAGCTGTGGGCGTCCGAGCTCGACTAGTCTGTTCTCTTCAGCCACTAGCT
TTTTTCTCTGGAGCTCAAGGCCAAGATGAAAGGGAATATGAAGGAGCACCACCAGTCTCTTCAAGAGCGGCCAAG
GCCCAAGAGGCTGTGTCAAAGTATCAAGGCTTGGCTGGAAAGGTGAATGCCACCTCTTCAATTCCAACGAGTAGT
GCTCGTGCTGCAAGCCGTTCAGCAGCGTTATCCCGATTGGGCAACGCAAGAGCACCTGTAGCCAAGCCCAACCCT
TGTACCTCACCGCCGACTTTACGCCACCAGTTGGACAGGCCGGGAGAGCTGAATAAGTCTTCCTTTCCTGTGTAC
TGGGTGGAAGTGCTCGACACTGGCCATCAAAAGTGGCAACCTGTTGATGCCGTCGTGTTGGGGTCTATGTGGAAC
ACCAAGGCCTTTGACCCGCCCATTACGGACAAGGCCAATTATCTTTCATACGTGGTGGCTTTTGAGGCCGACGGA
AGGGCCAAAGACGTGACAAGAAGATATGCAAAAGCCTATACAGCAAAGACACGCAAGCTGCGCGTTGAGAGTGCC
ACAGATGATGGGCAGATGTGGTGGGAAGGAGTCATGAAGTTTTTCAAAGCAAAGAGGCCGTCAGACTTGGATCAG
ATTGAAGATGGCGAGTTGGCTAGTGCCGAGGCCAGGGAGCCGATGCCACGGAACCTGCAAGACTTCAAGAAGCAC
CCCGTGTACGCTTTGGAGCGACACTTGAGACGAAATGAAGTGCTGGTAGAGGGGGCGACGGTATGTGGTACCGTG
GGAGCTACGGGCAGCCGAGGCGTTCTGGACAAGATTTATCGACGCAAGGACGTGCGAATTGCCAGAAGTGCGGAC
AAATGGTACCGTCTTGGGCGCCAAGTCAAAGCAAACGAGATAGCGGCCAAGTGGCTTCCCAGCAAACGAAGAGAC
AACGGGGAGGATGGGGTGGATGATGGCGGTGGCGGAGGAACTCCCATTTACACGATTGATCAGACAGAGCTTTTC
CAAGCACCCCCTGTACTCAATGGACAAGTGCCCAAGAACAAGTTTGGCAACGTGGACCTGTACGTGGATAGCATG
TTGCCCAGGGGCGGAGTTCATATCCGTGGCCAAGACGCCTCTCGTGCGGCCTTCTTGCTTGGGATTGACTATGCA
CCAGCATTGACGGGATTCCAGTTTCAAGGGCGGCATGGAACGGCAGTGCTTGACGGCGTGGTGGTGGCTGCTGAG
TACGTGGAAGCCGTAGAGGCTGTCATTGCGGGCTTGGAGCAGCTAAAGGAAGAGGCGTCACGAGAGATTCGAATG
GCGCAAGTACTAGGCAAGTGGAGGCGGCTGATGGTTGGGTTGAGGATTCGAGAAAGAATATGGAGTGGAGTGGAC
GCAGCGGAACGGCAAGAGGCAGAAAGATGCCAGATGGATGACGACAATGACGACAATGACGATTACGGAGGAGGC
GGGTGGCTACCGGAATGA
Transcript >OphauG2|3345
ATGGTTAGAAGCCGACGGCCCAGAAACGCCGCTGACGAGGGCAACATCTACCAGCAGATGCTGGCCGAGGCAGGC
GTCTCTACATGGGCAAGGGACTCTCCAGCTCGCCCGTTGAAAAGGAGGCGAGGTGGGCCGCATACACCCTCCATC
ATTTCTCCAGACCCCCACGTTGGGAAGCATGACGACACGGCCAGTAGCAGCGACAAGGCCGACGACAAGGCCGAC
GACAAGGCCGACGACAGCCACGACGACGACGACGAATCCATCGAGTTTGAAGATGTCCCTTTGCCCCGGCCAACG
CTTCAGACTCTGGAGCGAGACTCGGACGACGAGCCAGACGACCAGCAAGACCAAGATCTGCTGCACCTTGACAAG
GTGCCGTTGCCTCGGCTCAGCGATGCAACGCCGATCCATCGTGGTGCCGCACTGTTGCAACTCAACCTGTCCGCT
CAGCAGCAATCTGCAACCTCGGTCAAAAGGGGCGCTCAGAGACGCAAGCCACTCACCAAGGAGGAGCGGATGCGA
CGTATCGACCTGCACAAGGCACATCTTGTGTGCCTGCTTGCGCACGTCGCCCGAAGAAACCACTGGTGCAACGAT
GTCGAGGCACAAGAGCGCCTTGTCCAGCTCCTGGATGAAAAAACAGCTTCGAGTCTCAATCCTCAAAGACACTTG
GCCCAATTTACACAAACTGAAAAATTGAAGCTTGGCCTGAGACAGACTTTGAATCTGTGGAAAAACAAGTATGCC
GTCACGGAGAAAGGCCTTGATAGAGCGTCATGCCCTCGACATGCCGACGTGCTCAAGGACTGTGAGCCCCCACGC
GCCATGGATTCTTGCTTTGATCGTGCCAGCTTTCGCGAGGCGGCCAAGAAGCTACAAGGATCTCGTGACTTGGGC
GCACAGCTATACTGTGCCTTGCTTCGAGCTGTGGGCGTCCGAGCTCGACTAGTCTGTTCTCTTCAGCCACTAGCT
TTTTTCTCTGGAGCTCAAGGCCAAGATGAAAGGGAATATGAAGGAGCACCACCAGTCTCTTCAAGAGCGGCCAAG
GCCCAAGAGGCTGTGTCAAAGTATCAAGGCTTGGCTGGAAAGGTGAATGCCACCTCTTCAATTCCAACGAGTAGT
GCTCGTGCTGCAAGCCGTTCAGCAGCGTTATCCCGATTGGGCAACGCAAGAGCACCTGTAGCCAAGCCCAACCCT
TGTACCTCACCGCCGACTTTACGCCACCAGTTGGACAGGCCGGGAGAGCTGAATAAGTCTTCCTTTCCTGTGTAC
TGGGTGGAAGTGCTCGACACTGGCCATCAAAAGTGGCAACCTGTTGATGCCGTCGTGTTGGGGTCTATGTGGAAC
ACCAAGGCCTTTGACCCGCCCATTACGGACAAGGCCAATTATCTTTCATACGTGGTGGCTTTTGAGGCCGACGGA
AGGGCCAAAGACGTGACAAGAAGATATGCAAAAGCCTATACAGCAAAGACACGCAAGCTGCGCGTTGAGAGTGCC
ACAGATGATGGGCAGATGTGGTGGGAAGGAGTCATGAAGTTTTTCAAAGCAAAGAGGCCGTCAGACTTGGATCAG
ATTGAAGATGGCGAGTTGGCTAGTGCCGAGGCCAGGGAGCCGATGCCACGGAACCTGCAAGACTTCAAGAAGCAC
CCCGTGTACGCTTTGGAGCGACACTTGAGACGAAATGAAGTGCTGGTAGAGGGGGCGACGGTATGTGGTACCGTG
GGAGCTACGGGCAGCCGAGGCGTTCTGGACAAGATTTATCGACGCAAGGACGTGCGAATTGCCAGAAGTGCGGAC
AAATGGTACCGTCTTGGGCGCCAAGTCAAAGCAAACGAGATAGCGGCCAAGTGGCTTCCCAGCAAACGAAGAGAC
AACGGGGAGGATGGGGTGGATGATGGCGGTGGCGGAGGAACTCCCATTTACACGATTGATCAGACAGAGCTTTTC
CAAGCACCCCCTGTACTCAATGGACAAGTGCCCAAGAACAAGTTTGGCAACGTGGACCTGTACGTGGATAGCATG
TTGCCCAGGGGCGGAGTTCATATCCGTGGCCAAGACGCCTCTCGTGCGGCCTTCTTGCTTGGGATTGACTATGCA
CCAGCATTGACGGGATTCCAGTTTCAAGGGCGGCATGGAACGGCAGTGCTTGACGGCGTGGTGGTGGCTGCTGAG
TACGTGGAAGCCGTAGAGGCTGTCATTGCGGGCTTGGAGCAGCTAAAGGAAGAGGCGTCACGAGAGATTCGAATG
GCGCAAGTACTAGGCAAGTGGAGGCGGCTGATGGTTGGGTTGAGGATTCGAGAAAGAATATGGAGTGGAGTGGAC
GCAGCGGAACGGCAAGAGGCAGAAAGATGCCAGATGGATGACGACAATGACGACAATGACGATTACGGAGGAGGC
GGGTGGCTACCGGAATGA
Gene >OphauG2|3345
ATGGTTAGAAGCCGACGGCCCAGAAACGCCGCTGACGAGGGCAACATCTACCAGCAGATGCTGGCCGAGGCAGGC
GTCTCTACATGGGCAAGGGACTCTCCAGCTCGCCCGTTGAAAAGGAGGCGAGGTGGGCCGCATACACCCTCCATC
ATTTCTCCAGACCCCCACGTTGGGAAGCATGACGACACGGCCAGTAGCAGCGACAAGGCCGACGACAAGGCCGAC
GACAAGGCCGACGACAGCCACGACGACGACGACGAATCCATCGAGTTTGAAGATGTCCCTTTGCCCCGGCCAACG
CTTCAGACTCTGGAGCGAGACTCGGACGACGAGCCAGACGACCAGCAAGACCAAGATCTGCTGCACCTTGACAAG
GTGCCGTTGCCTCGGCTCAGCGATGCAACGCCGATCCATCGTGGTGCCGCACTGTTGCAACTCAACCTGTCCGCT
CAGCAGCAATCTGCAACCTCGGTCAAAAGGGGCGCTCAGAGACGCAAGCCACTCACCAAGGAGGAGCGGATGCGA
CGTATCGACCTGCACAAGGCACATCTTGTGTGCCTGCTTGCGCACGTCGCCCGAAGAAACCACTGGTGCAACGAT
GTCGAGGCACAAGAGCGCCTTGTCCAGCTCCTGGATGAAAAAACAGCTTCGAGTCTCAATCCTCAAAGACACTTG
GCCCAATTTACACAAACTGAAAAATTGAAGCTTGGCCTGAGACAGACTTTGAATCTGTGGAAAAACAAGTATGCC
GTCACGGAGAAAGGCCTTGATAGAGCGTCATGCCCTCGACATGCCGACGTGCTCAAGGACGTGAGTCACCTATGC
TCCGCTGCACGTCTGCCGGTCAAGCCATGACATGCTTCTGACAAGTTTGGCAGTGTGAGCCCCCACGCGCCATGG
ATTCTTGCTTTGATCGTGCCAGCTTTCGCGAGGCGGCCAAGAAGCTACAAGGATCTCGTGACTTGGGCGCACAGC
TATACTGTGCCTTGCTTCGAGCTGTGGGCGTCCGAGCTCGACTAGTCTGTTCTCTTCAGCCACTAGCTTTTTTCT
CTGGAGCTCAAGGCCAAGATGAAAGGGAATATGAAGGAGCACCACCAGTCTCTTCAAGAGCGGCCAAGGCCCAAG
AGGCTGTGTCAAAGTATCAAGGCTTGGCTGGAAAGGTGAATGCCACCTCTTCAATTCCAACGAGTAGTGCTCGTG
CTGCAAGCCGTTCAGCAGCGTTATCCCGATTGGGCAACGCAAGAGCACCTGTAGCCAAGCCCAACCCTTGTACCT
CACCGCCGACTTTACGCCACCAGTTGGACAGGCCGGGAGAGCTGAATAAGTCTTCCTTTCCTGTGTACTGGGTGG
AAGTGCTCGACACTGGCCATCAAAAGTGGCAACCTGTTGATGCCGTCGTGTTGGGGTCTATGTGGAACACCAAGG
CCTTTGACCCGCCCATTACGGACAAGGCCAATTATCTTTCATACGTGGTGGCTTTTGAGGCCGACGGAAGGGCCA
AAGACGTGACAAGAAGATATGCAAAAGCCTATACAGCAAAGACACGCAAGCTGCGCGTTGAGAGTGCCACAGATG
ATGGGCAGATGTGGTGGGAAGGAGTCATGAAGTTTTTCAAAGCAAAGAGGCCGTCAGACTTGGATCAGATTGAAG
ATGGCGAGTTGGCTAGTGCCGAGGCCAGGGAGCCGATGCCACGGAACCTGCAAGACTTCAAGAAGCACCCCGTGT
ACGCTTTGGAGCGACACTTGAGACGAAATGAAGTGCTGGTAGAGGGGGCGACGGTATGTGGTACCGTGGGAGCTA
CGGGCAGCCGAGGCGTTCTGGACAAGATTTATCGACGCAAGGACGTGCGAATTGCCAGAAGTGCGGACAAATGGT
ACCGTCTTGGGCGCCAAGTCAAAGCAAACGAGATAGCGGCCAAGTGGCTTCCCAGCAAACGAAGAGACAACGGGG
AGGATGGGGTGGATGATGGCGGTGGCGGAGGAACTCCCATTTACACGATTGATCAGACAGAGCTTTTCCAAGCAC
CCCCTGTACTCAATGGACAAGTGCCCAAGAACAAGTTTGGCAACGTGGACCTGTACGTGGATAGCATGTTGCCCA
GGGGCGGAGTTCATATCCGTGGCCAAGACGCCTCTCGTGCGGCCTTCTTGCTTGGGATTGACTATGCACCAGCAT
TGACGGGATTCCAGTTTCAAGGGCGGCATGGAACGGCAGTGCTTGACGGCGTGGTGGTGGCTGCTGAGTACGTGG
AAGCCGTAGAGGCTGTCATTGCGGGCTTGGAGCAGCTAAAGGAAGAGGCGTCACGAGAGATTCGAATGGCGCAAG
TACTAGGCAAGTGGAGGCGGCTGATGGTTGGGTTGAGGATTCGAGAAAGAATATGGAGTGGAGTGGACGCAGCGG
AACGGCAAGAGGCAGAAAGATGCCAGATGGATGACGACAATGACGACAATGACGATTACGGAGGAGGCGGGTGGC
TACCGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail