Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3341
Gene name
LocationContig_250:5156..6147
Strand-
Gene length (bp)991
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01265 Cyto_heme_lyase Cytochrome c/c1 heme lyase 2.8E-119 1 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14187|CCHL_NEUCR Cytochrome c heme lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-2 PE=3 SV=1 1 300 7.0E-120
sp|P53700|CCHL_CANAW Cytochrome c heme lyase OS=Candida albicans (strain WO-1) GN=CYC3 PE=3 SV=2 1 293 2.0E-58
sp|O74794|CCHL_SCHPO Putative cytochrome c heme lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.12 PE=3 SV=1 19 292 1.0E-47
sp|P06182|CCHL_YEAST Cytochrome c heme lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC3 PE=1 SV=1 1 283 8.0E-47
sp|Q5F339|CCHL_CHICK Cytochrome c-type heme lyase OS=Gallus gallus GN=HCCS PE=2 SV=1 45 290 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14187|CCHL_NEUCR Cytochrome c heme lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-2 PE=3 SV=1 1 300 7.0E-120
sp|P53700|CCHL_CANAW Cytochrome c heme lyase OS=Candida albicans (strain WO-1) GN=CYC3 PE=3 SV=2 1 293 2.0E-58
sp|O74794|CCHL_SCHPO Putative cytochrome c heme lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.12 PE=3 SV=1 19 292 1.0E-47
sp|P06182|CCHL_YEAST Cytochrome c heme lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC3 PE=1 SV=1 1 283 8.0E-47
sp|Q5F339|CCHL_CHICK Cytochrome c-type heme lyase OS=Gallus gallus GN=HCCS PE=2 SV=1 45 290 2.0E-33
sp|Q552W5|CCHL_DICDI Probable cytochrome c-type heme lyase OS=Dictyostelium discoideum GN=cchl PE=3 SV=1 45 283 5.0E-32
sp|P53703|CCHL_CAEEL Probable cytochrome c-type heme lyase OS=Caenorhabditis elegans GN=cchl-1 PE=3 SV=1 65 275 1.0E-31
sp|P53702|CCHL_MOUSE Cytochrome c-type heme lyase OS=Mus musculus GN=Hccs PE=1 SV=2 46 290 2.0E-31
sp|P53701|CCHL_HUMAN Cytochrome c-type heme lyase OS=Homo sapiens GN=HCCS PE=1 SV=1 22 290 6.0E-31
sp|A5PJG7|CCHL_BOVIN Cytochrome c-type heme lyase OS=Bos taurus GN=HCCS PE=2 SV=1 46 290 2.0E-30
sp|O13962|YE42_SCHPO Putative cytochrome c1 heme lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.02c PE=3 SV=1 89 286 4.0E-25
sp|Q00873|CYT2_YEAST Cytochrome c1 heme lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYT2 PE=3 SV=1 75 269 7.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0004408 holocytochrome-c synthase activity Yes
GO:0005739 mitochondrion Yes
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0043227 membrane-bounded organelle No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0016846 carbon-sulfur lyase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016829 lyase activity No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup480
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3341 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7016
Ophiocordyceps camponoti-floridani Ophcf2|01128
Ophiocordyceps camponoti-rufipedis Ophun1|7178
Ophiocordyceps camponoti-rufipedis Ophun1|7179
Ophiocordyceps kimflemingae Ophio5|2491
Ophiocordyceps kimflemingae Ophio5|5247
Ophiocordyceps subramaniannii Hirsu2|1062

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3341
MGWFWADASPTRVRDAHPSCPISSTSPTFVDKTSTKVASPPTTSGCPVPHAASRPNESNSSSILSQLNPLNYMFR
DLSQKPAPNQTYALSTSREESTIPKGSGNGTWEYPSPQQMYNALLRKGYTDTDITAIPSMVSVHNFLNEGAWAEI
VGWEQRFAQGLYKGWKICRRGEGHAQEEIERHRDLDFHDPTLVRFQGRPTDMTPKATIIQLLGRVFPAKFGTEPP
FDRHDWYVSRNTNGQNKEVRYVIDYYSGEPEPTGEPVFYLDVRPAATPLGATERLIRWGTDVWWRAMGTEKREQD
PEPFLNFQKRS*
Coding >OphauG2|3341
ATGGGTTGGTTTTGGGCCGACGCTTCGCCAACACGCGTGCGCGATGCCCATCCCTCATGTCCCATCTCAAGCACC
AGCCCAACCTTCGTCGACAAGACCTCGACAAAAGTTGCCTCCCCTCCCACTACCTCGGGCTGCCCCGTTCCCCAT
GCCGCGTCTCGACCCAACGAATCGAATTCCAGCTCTATTCTATCACAGCTCAACCCTCTCAACTACATGTTCCGC
GACTTGTCCCAGAAACCCGCTCCCAACCAGACCTACGCCCTGTCGACGTCGCGCGAAGAATCCACCATTCCAAAG
GGCTCCGGCAATGGCACCTGGGAGTATCCTTCGCCACAGCAAATGTACAATGCACTGCTGAGAAAGGGCTACACC
GATACCGATATCACGGCCATCCCCTCCATGGTGTCGGTCCACAACTTCCTCAACGAGGGTGCCTGGGCTGAGATT
GTTGGCTGGGAACAACGCTTCGCTCAAGGCCTCTACAAAGGCTGGAAGATCTGCCGTCGCGGCGAGGGTCACGCT
CAAGAGGAAATCGAGCGCCATCGCGACCTGGATTTCCATGATCCCACTCTGGTTCGCTTCCAGGGCCGTCCCACC
GACATGACACCGAAAGCAACTATTATACAGCTGCTGGGCCGAGTTTTCCCGGCTAAATTTGGCACGGAACCGCCC
TTTGATCGTCACGACTGGTACGTTTCGCGCAACACCAATGGCCAAAACAAAGAGGTTCGCTACGTAATCGACTAC
TACTCCGGCGAGCCTGAGCCCACAGGCGAGCCCGTCTTTTACCTCGATGTTCGCCCAGCTGCCACGCCTTTGGGC
GCAACTGAGAGGCTGATACGATGGGGAACTGATGTATGGTGGAGAGCAATGGGTACCGAAAAACGGGAGCAGGAC
CCCGAACCCTTCTTGAATTTTCAAAAGCGCTCATGA
Transcript >OphauG2|3341
ATGGGTTGGTTTTGGGCCGACGCTTCGCCAACACGCGTGCGCGATGCCCATCCCTCATGTCCCATCTCAAGCACC
AGCCCAACCTTCGTCGACAAGACCTCGACAAAAGTTGCCTCCCCTCCCACTACCTCGGGCTGCCCCGTTCCCCAT
GCCGCGTCTCGACCCAACGAATCGAATTCCAGCTCTATTCTATCACAGCTCAACCCTCTCAACTACATGTTCCGC
GACTTGTCCCAGAAACCCGCTCCCAACCAGACCTACGCCCTGTCGACGTCGCGCGAAGAATCCACCATTCCAAAG
GGCTCCGGCAATGGCACCTGGGAGTATCCTTCGCCACAGCAAATGTACAATGCACTGCTGAGAAAGGGCTACACC
GATACCGATATCACGGCCATCCCCTCCATGGTGTCGGTCCACAACTTCCTCAACGAGGGTGCCTGGGCTGAGATT
GTTGGCTGGGAACAACGCTTCGCTCAAGGCCTCTACAAAGGCTGGAAGATCTGCCGTCGCGGCGAGGGTCACGCT
CAAGAGGAAATCGAGCGCCATCGCGACCTGGATTTCCATGATCCCACTCTGGTTCGCTTCCAGGGCCGTCCCACC
GACATGACACCGAAAGCAACTATTATACAGCTGCTGGGCCGAGTTTTCCCGGCTAAATTTGGCACGGAACCGCCC
TTTGATCGTCACGACTGGTACGTTTCGCGCAACACCAATGGCCAAAACAAAGAGGTTCGCTACGTAATCGACTAC
TACTCCGGCGAGCCTGAGCCCACAGGCGAGCCCGTCTTTTACCTCGATGTTCGCCCAGCTGCCACGCCTTTGGGC
GCAACTGAGAGGCTGATACGATGGGGAACTGATGTATGGTGGAGAGCAATGGGTACCGAAAAACGGGAGCAGGAC
CCCGAACCCTTCTTGAATTTTCAAAAGCGCTCATGA
Gene >OphauG2|3341
ATGGGTTGGTTTTGGGCCGACGCTTCGCCAACACGCGTGCGCGATGCCCATCCCTCATGTCCCATCTCAAGCACC
AGCCCAACCTTCGTCGACAAGACCTCGACAAAAGTTGCCTCCCCTCCCACTACCTCGGGCTGCCCCGTTCCCCAT
GCCGCGTCTCGACCCAACGAATCGAATTCCAGCTCTATTCTATCACAGCTCAACCCTCTCAACTACATGTTCCGC
GACTTGTCCCAGAAACCCGCTCCCAACCAGACCTACGCCCTGTCGACGTCGCGCGAAGAATCCACCATTCCAAAG
GGCTCCGGCAATGGCACCTGGGAGTATCCTTCGCCACAGCAAATGTACAATGCACTGCTGAGAAAGGGCTACACC
GATACCGATATCACGGCCATCCCCTCCATGGTGTCGGTCCACAACTTCCTCAACGAGGGTGCCTGGGCTGAGATT
GTTGGCTGGGAACAACGCTTCGCTCAAGGCCTCTACAAAGGCTGGAAGATCTGCCGTCGCGGCGAGGGTCACGCT
CAAGAGGAAATCGAGCGCCATCGCGACCTGGATTTCCATGATCCCACTCTGGTTCGCTTCCAGGGCCGTCCCACC
GACATGACACCGAAAGCAACTATTATACAGCTGCTGGGCCGAGTTTTCCCGGCTAAATTTGGGTAGCTCACCCCA
TTCTGCCTTGGCCATAGTTTACCCTTTACTGACAGAATAAAGCACGGAACCGCCCTTTGATCGTCACGACTGGTA
CGTTTCGCGCAACACCAATGGCCAAAACAAAGAGGTTCGCTACGTAATCGACTACTACTCCGGCGAGCCTGAGCC
CACAGGCGAGCCCGTCTTTTACCTCGATGTTCGCCCAGCTGCCACGCCTTTGGGCGCAACTGAGAGGCTGATACG
ATGGGGAACTGATGTATGGTGGAGAGCAATGGGTACCGAAAAACGGGAGCAGGACCCCGAACCCTTCTTGAATTT
TCAAAAGCGCTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail