Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3335
Gene name
LocationContig_25:45399..48309
Strand+
Gene length (bp)2910
Transcript length (bp)2859
Coding sequence length (bp)2859
Protein length (aa) 953

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain 9.1E-20 756 918

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02724|ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP1 PE=1 SV=1 746 944 6.0E-17
sp|Q94F30|ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana GN=ESD4 PE=1 SV=1 705 939 2.0E-12
sp|O42957|ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp1 PE=3 SV=1 755 940 2.0E-12
sp|O65278|ULP1B_ARATH Putative ubiquitin-like-specific protease 1B OS=Arabidopsis thaliana GN=ULP1B PE=5 SV=2 649 935 6.0E-12
sp|Q8GYL3|ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana GN=ULP1A PE=2 SV=2 751 924 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02724|ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP1 PE=1 SV=1 746 944 6.0E-17
sp|Q94F30|ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana GN=ESD4 PE=1 SV=1 705 939 2.0E-12
sp|O42957|ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp1 PE=3 SV=1 755 940 2.0E-12
sp|O65278|ULP1B_ARATH Putative ubiquitin-like-specific protease 1B OS=Arabidopsis thaliana GN=ULP1B PE=5 SV=2 649 935 6.0E-12
sp|Q8GYL3|ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana GN=ULP1A PE=2 SV=2 751 924 4.0E-10
sp|Q9EQE1|SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus GN=Senp2 PE=1 SV=1 756 909 4.0E-09
sp|Q5R7K7|SENP2_PONAB Sentrin-specific protease 2 OS=Pongo abelii GN=SENP2 PE=2 SV=1 756 909 2.0E-08
sp|Q91ZX6|SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus GN=Senp2 PE=1 SV=2 756 909 3.0E-08
sp|Q9HC62|SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens GN=SENP2 PE=1 SV=3 756 909 7.0E-08
sp|Q9H4L4|SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens GN=SENP3 PE=1 SV=2 719 934 2.0E-07
sp|Q9EP97|SENP3_MOUSE Sentrin-specific protease 3 OS=Mus musculus GN=Senp3 PE=1 SV=1 719 934 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008234 cysteine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3335 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04285
Ophiocordyceps camponoti-rufipedis Ophun1|2103
Ophiocordyceps kimflemingae Ophio5|969
Ophiocordyceps subramaniannii Hirsu2|3497

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3335
MVTKTYSTFIKLGQKAASWYNGTSNAIDIGSCDASLHVAFKRVKLNPFDSTSAVWTPRRHCSSFLSDKDHFVYLL
RRILNIALFRPDHASTNRIVCPLTNALCSFNVDGLAALHGQGEPRDLFLGQVNNCISICMDLYNLKSLERMVGFC
SFKPLNFDYHLSPLALDKFEQAQRFLSAPFVLSVFKSLLQLDQPEGVVHFSTSFLDIFLLDLQAILKGIILPSLI
DSKLFHHKIRQLLPLPRRRNVPDIWAPMPGCWPDEMDETNSDITDHDVADEVVSDMTDYPDEADLEYHHKSISEQ
VFGDDQNLNDTQPAELVESIELVESSELVESPELVESPELVESTELVENTNVQETVDDIDFPPESQEDAAVYLQE
VSARLQGGAAKERPSSPMKQRLLSPVEQTLKSPPVEVERIDSPTPSYKSRGHNYHAYTEELRGFIFNMDAQELRD
TYYRESDAHKAIKSTYVTDFVPKQPPTPSKQLAMSSILRNRTKNISKCIPARLRMSRPPKEVRFVDGTIDPQPRS
RIGLDVPRLLERDLDRATDDDPHDRPWNRGEVAGTAVFDWPRVPDIDLERSRTPEWTQLILKGKSCSLLKTQETS
PMQRIRELVSSPTDPCLKFEAGLTDEEYPHRARLWAEEVERIETKQRKKEEAERQAAAEEAARQEAARQAAEEAA
RQAAEEAAAKQAAEDAAQKLAARSGLLRRPRKPLISPVSATWSIKAEKTMSSSAAVSHAKTGEGSDLRRHDFASV
ITPTRWLNDEIINGTIIWIDRAVNEAAGIQDTRRQTRKCLAMNSFFFKDLLAKGPAGTDRKLRRNGVNKNNFLDV
ETILLPVCERSHWTLMVIRPKHRTVAHMDSLNPAGDVRYANLTMECVKSVLEERFIASDWKVVRHEAPRQSNGYD
CGVFTITNALCLALGLDPVLSYEEGDLEVQRMRIACVLLNEGFKGDFALEGF*
Coding >OphauG2|3335
ATGGTGACCAAGACTTACTCTACCTTTATTAAGCTTGGCCAAAAGGCGGCAAGTTGGTACAACGGGACTTCCAAT
GCCATTGACATTGGGTCTTGCGATGCCTCGCTGCATGTGGCATTCAAGAGGGTCAAGCTCAACCCATTTGACAGC
ACCAGTGCTGTCTGGACACCTCGTCGACACTGCAGCTCTTTTCTTTCCGACAAAGACCACTTTGTTTATCTCCTT
CGCCGGATTCTCAACATTGCTCTTTTCAGACCTGATCATGCCTCCACTAATCGGATTGTCTGCCCCCTCACCAAT
GCACTATGCAGTTTCAATGTCGACGGATTGGCCGCCTTGCATGGGCAGGGTGAGCCTCGTGACCTTTTTCTCGGA
CAGGTCAATAACTGCATATCAATTTGCATGGATCTTTACAACCTCAAGTCCCTTGAACGCATGGTTGGATTCTGT
TCATTCAAGCCACTCAATTTTGACTATCATCTTTCTCCCTTGGCACTTGACAAATTTGAACAGGCCCAAAGATTC
CTCTCGGCTCCCTTTGTCCTCAGTGTCTTCAAAAGTCTTCTGCAGTTGGACCAGCCAGAGGGAGTCGTTCATTTC
TCAACTTCTTTCCTTGATATCTTTCTATTGGACTTGCAGGCCATCTTGAAGGGCATCATTTTACCAAGCCTGATC
GACTCTAAGTTGTTTCACCACAAGATTCGTCAGCTCCTTCCTTTGCCTCGCCGACGCAATGTCCCTGACATTTGG
GCTCCTATGCCTGGATGCTGGCCTGATGAAATGGACGAGACGAATTCGGATATCACAGACCATGATGTTGCCGAC
GAAGTTGTCTCAGACATGACTGACTACCCTGATGAAGCTGACCTTGAGTACCATCACAAGAGCATTTCTGAGCAG
GTATTTGGCGACGACCAGAACCTCAACGACACACAGCCAGCCGAGCTGGTTGAGTCTATTGAGTTGGTTGAGTCT
TCTGAGCTGGTTGAGTCTCCTGAGCTGGTTGAGTCTCCTGAGCTGGTTGAGTCTACTGAGCTGGTTGAGAACACC
AATGTCCAGGAAACTGTTGACGATATTGATTTCCCTCCGGAGAGCCAGGAGGATGCTGCTGTCTATCTCCAAGAA
GTTTCAGCTCGCCTCCAGGGTGGAGCGGCTAAAGAGCGACCTTCCTCGCCGATGAAGCAACGACTGCTTTCACCT
GTGGAGCAGACTTTGAAGTCGCCGCCAGTGGAGGTGGAACGAATTGATTCCCCGACCCCCTCATACAAGAGTCGC
GGTCACAATTACCACGCCTACACTGAAGAGCTGCGAGGGTTTATCTTCAACATGGATGCTCAAGAACTTCGGGAC
ACATACTATCGCGAAAGCGATGCTCACAAAGCAATCAAGTCAACGTATGTCACGGATTTTGTGCCCAAGCAACCA
CCCACACCATCCAAGCAACTAGCGATGTCTTCAATTTTACGCAATCGCACGAAGAACATTTCCAAATGCATACCC
GCGAGACTACGTATGTCGCGCCCGCCCAAGGAAGTTCGATTTGTGGATGGTACCATTGATCCACAGCCGCGAAGT
CGTATTGGCCTGGATGTGCCGAGACTTCTTGAGAGAGATTTAGACAGAGCTACGGACGATGATCCTCATGATCGT
CCTTGGAACAGAGGCGAAGTGGCAGGGACGGCAGTGTTCGACTGGCCGAGAGTTCCAGACATTGATTTGGAACGG
TCGCGGACTCCCGAATGGACTCAGCTCATACTCAAAGGGAAGTCTTGCTCCTTGTTGAAGACCCAGGAGACCTCG
CCCATGCAGCGCATCCGTGAGCTGGTTTCTAGCCCTACCGATCCTTGCTTGAAGTTTGAGGCTGGGCTTACAGAT
GAGGAATATCCTCATCGGGCGCGTTTGTGGGCCGAAGAGGTTGAACGCATTGAAACCAAACAGCGAAAGAAAGAG
GAAGCGGAGAGGCAGGCGGCGGCTGAAGAAGCTGCGAGACAGGAGGCTGCGAGACAGGCTGCAGAGGAAGCGGCT
AGACAAGCGGCTGAAGAGGCAGCTGCCAAGCAAGCAGCAGAAGATGCTGCACAAAAACTGGCTGCTCGGTCAGGT
CTCCTTCGCAGACCTCGAAAGCCTCTTATCTCACCAGTCAGCGCCACGTGGTCCATCAAAGCTGAGAAAACAATG
TCATCGAGTGCTGCAGTGTCGCATGCAAAGACTGGTGAGGGAAGCGACCTCAGACGCCACGACTTTGCCTCAGTC
ATTACTCCGACGAGATGGCTTAACGACGAGATCATCAATGGCACAATTATATGGATCGATCGGGCTGTTAATGAA
GCTGCTGGTATTCAAGACACTCGACGTCAGACTCGCAAGTGTCTAGCAATGAACTCATTCTTTTTTAAGGATCTT
CTGGCAAAGGGACCAGCGGGGACAGACCGCAAACTGAGGCGCAACGGGGTTAACAAGAACAATTTCCTTGACGTG
GAAACGATTCTTTTGCCTGTGTGCGAACGGTCGCATTGGACCTTGATGGTGATTCGTCCCAAACACAGGACTGTG
GCGCACATGGACTCTTTGAACCCGGCTGGAGACGTGCGATATGCGAATTTGACAATGGAATGTGTCAAAAGTGTC
TTGGAGGAAAGGTTTATAGCATCGGACTGGAAAGTGGTACGTCATGAAGCGCCTCGACAAAGCAACGGATATGAC
TGCGGTGTCTTCACCATTACCAATGCTCTTTGCCTCGCACTTGGTCTGGACCCGGTTCTCAGTTACGAGGAAGGC
GATTTGGAGGTGCAGAGGATGCGGATTGCTTGCGTGCTTTTGAACGAAGGATTCAAGGGGGATTTTGCCTTGGAG
GGGTTTTGA
Transcript >OphauG2|3335
ATGGTGACCAAGACTTACTCTACCTTTATTAAGCTTGGCCAAAAGGCGGCAAGTTGGTACAACGGGACTTCCAAT
GCCATTGACATTGGGTCTTGCGATGCCTCGCTGCATGTGGCATTCAAGAGGGTCAAGCTCAACCCATTTGACAGC
ACCAGTGCTGTCTGGACACCTCGTCGACACTGCAGCTCTTTTCTTTCCGACAAAGACCACTTTGTTTATCTCCTT
CGCCGGATTCTCAACATTGCTCTTTTCAGACCTGATCATGCCTCCACTAATCGGATTGTCTGCCCCCTCACCAAT
GCACTATGCAGTTTCAATGTCGACGGATTGGCCGCCTTGCATGGGCAGGGTGAGCCTCGTGACCTTTTTCTCGGA
CAGGTCAATAACTGCATATCAATTTGCATGGATCTTTACAACCTCAAGTCCCTTGAACGCATGGTTGGATTCTGT
TCATTCAAGCCACTCAATTTTGACTATCATCTTTCTCCCTTGGCACTTGACAAATTTGAACAGGCCCAAAGATTC
CTCTCGGCTCCCTTTGTCCTCAGTGTCTTCAAAAGTCTTCTGCAGTTGGACCAGCCAGAGGGAGTCGTTCATTTC
TCAACTTCTTTCCTTGATATCTTTCTATTGGACTTGCAGGCCATCTTGAAGGGCATCATTTTACCAAGCCTGATC
GACTCTAAGTTGTTTCACCACAAGATTCGTCAGCTCCTTCCTTTGCCTCGCCGACGCAATGTCCCTGACATTTGG
GCTCCTATGCCTGGATGCTGGCCTGATGAAATGGACGAGACGAATTCGGATATCACAGACCATGATGTTGCCGAC
GAAGTTGTCTCAGACATGACTGACTACCCTGATGAAGCTGACCTTGAGTACCATCACAAGAGCATTTCTGAGCAG
GTATTTGGCGACGACCAGAACCTCAACGACACACAGCCAGCCGAGCTGGTTGAGTCTATTGAGTTGGTTGAGTCT
TCTGAGCTGGTTGAGTCTCCTGAGCTGGTTGAGTCTCCTGAGCTGGTTGAGTCTACTGAGCTGGTTGAGAACACC
AATGTCCAGGAAACTGTTGACGATATTGATTTCCCTCCGGAGAGCCAGGAGGATGCTGCTGTCTATCTCCAAGAA
GTTTCAGCTCGCCTCCAGGGTGGAGCGGCTAAAGAGCGACCTTCCTCGCCGATGAAGCAACGACTGCTTTCACCT
GTGGAGCAGACTTTGAAGTCGCCGCCAGTGGAGGTGGAACGAATTGATTCCCCGACCCCCTCATACAAGAGTCGC
GGTCACAATTACCACGCCTACACTGAAGAGCTGCGAGGGTTTATCTTCAACATGGATGCTCAAGAACTTCGGGAC
ACATACTATCGCGAAAGCGATGCTCACAAAGCAATCAAGTCAACGTATGTCACGGATTTTGTGCCCAAGCAACCA
CCCACACCATCCAAGCAACTAGCGATGTCTTCAATTTTACGCAATCGCACGAAGAACATTTCCAAATGCATACCC
GCGAGACTACGTATGTCGCGCCCGCCCAAGGAAGTTCGATTTGTGGATGGTACCATTGATCCACAGCCGCGAAGT
CGTATTGGCCTGGATGTGCCGAGACTTCTTGAGAGAGATTTAGACAGAGCTACGGACGATGATCCTCATGATCGT
CCTTGGAACAGAGGCGAAGTGGCAGGGACGGCAGTGTTCGACTGGCCGAGAGTTCCAGACATTGATTTGGAACGG
TCGCGGACTCCCGAATGGACTCAGCTCATACTCAAAGGGAAGTCTTGCTCCTTGTTGAAGACCCAGGAGACCTCG
CCCATGCAGCGCATCCGTGAGCTGGTTTCTAGCCCTACCGATCCTTGCTTGAAGTTTGAGGCTGGGCTTACAGAT
GAGGAATATCCTCATCGGGCGCGTTTGTGGGCCGAAGAGGTTGAACGCATTGAAACCAAACAGCGAAAGAAAGAG
GAAGCGGAGAGGCAGGCGGCGGCTGAAGAAGCTGCGAGACAGGAGGCTGCGAGACAGGCTGCAGAGGAAGCGGCT
AGACAAGCGGCTGAAGAGGCAGCTGCCAAGCAAGCAGCAGAAGATGCTGCACAAAAACTGGCTGCTCGGTCAGGT
CTCCTTCGCAGACCTCGAAAGCCTCTTATCTCACCAGTCAGCGCCACGTGGTCCATCAAAGCTGAGAAAACAATG
TCATCGAGTGCTGCAGTGTCGCATGCAAAGACTGGTGAGGGAAGCGACCTCAGACGCCACGACTTTGCCTCAGTC
ATTACTCCGACGAGATGGCTTAACGACGAGATCATCAATGGCACAATTATATGGATCGATCGGGCTGTTAATGAA
GCTGCTGGTATTCAAGACACTCGACGTCAGACTCGCAAGTGTCTAGCAATGAACTCATTCTTTTTTAAGGATCTT
CTGGCAAAGGGACCAGCGGGGACAGACCGCAAACTGAGGCGCAACGGGGTTAACAAGAACAATTTCCTTGACGTG
GAAACGATTCTTTTGCCTGTGTGCGAACGGTCGCATTGGACCTTGATGGTGATTCGTCCCAAACACAGGACTGTG
GCGCACATGGACTCTTTGAACCCGGCTGGAGACGTGCGATATGCGAATTTGACAATGGAATGTGTCAAAAGTGTC
TTGGAGGAAAGGTTTATAGCATCGGACTGGAAAGTGGTACGTCATGAAGCGCCTCGACAAAGCAACGGATATGAC
TGCGGTGTCTTCACCATTACCAATGCTCTTTGCCTCGCACTTGGTCTGGACCCGGTTCTCAGTTACGAGGAAGGC
GATTTGGAGGTGCAGAGGATGCGGATTGCTTGCGTGCTTTTGAACGAAGGATTCAAGGGGGATTTTGCCTTGGAG
GGGTTTTGA
Gene >OphauG2|3335
ATGGTGACCAAGACTTACTCTACCTTTATTAAGCTTGGCCAAAAGGCGGCAAGTTGGTGTAAGTTGGCTCCTCAT
CCCATTGGCCCTTTACATTTGCTGACATCCATAGACAACGGGACTTCCAATGCCATTGACATTGGGTCTTGCGAT
GCCTCGCTGCATGTGGCATTCAAGAGGGTCAAGCTCAACCCATTTGACAGCACCAGTGCTGTCTGGACACCTCGT
CGACACTGCAGCTCTTTTCTTTCCGACAAAGACCACTTTGTTTATCTCCTTCGCCGGATTCTCAACATTGCTCTT
TTCAGACCTGATCATGCCTCCACTAATCGGATTGTCTGCCCCCTCACCAATGCACTATGCAGTTTCAATGTCGAC
GGATTGGCCGCCTTGCATGGGCAGGGTGAGCCTCGTGACCTTTTTCTCGGACAGGTCAATAACTGCATATCAATT
TGCATGGATCTTTACAACCTCAAGTCCCTTGAACGCATGGTTGGATTCTGTTCATTCAAGCCACTCAATTTTGAC
TATCATCTTTCTCCCTTGGCACTTGACAAATTTGAACAGGCCCAAAGATTCCTCTCGGCTCCCTTTGTCCTCAGT
GTCTTCAAAAGTCTTCTGCAGTTGGACCAGCCAGAGGGAGTCGTTCATTTCTCAACTTCTTTCCTTGATATCTTT
CTATTGGACTTGCAGGCCATCTTGAAGGGCATCATTTTACCAAGCCTGATCGACTCTAAGTTGTTTCACCACAAG
ATTCGTCAGCTCCTTCCTTTGCCTCGCCGACGCAATGTCCCTGACATTTGGGCTCCTATGCCTGGATGCTGGCCT
GATGAAATGGACGAGACGAATTCGGATATCACAGACCATGATGTTGCCGACGAAGTTGTCTCAGACATGACTGAC
TACCCTGATGAAGCTGACCTTGAGTACCATCACAAGAGCATTTCTGAGCAGGTATTTGGCGACGACCAGAACCTC
AACGACACACAGCCAGCCGAGCTGGTTGAGTCTATTGAGTTGGTTGAGTCTTCTGAGCTGGTTGAGTCTCCTGAG
CTGGTTGAGTCTCCTGAGCTGGTTGAGTCTACTGAGCTGGTTGAGAACACCAATGTCCAGGAAACTGTTGACGAT
ATTGATTTCCCTCCGGAGAGCCAGGAGGATGCTGCTGTCTATCTCCAAGAAGTTTCAGCTCGCCTCCAGGGTGGA
GCGGCTAAAGAGCGACCTTCCTCGCCGATGAAGCAACGACTGCTTTCACCTGTGGAGCAGACTTTGAAGTCGCCG
CCAGTGGAGGTGGAACGAATTGATTCCCCGACCCCCTCATACAAGAGTCGCGGTCACAATTACCACGCCTACACT
GAAGAGCTGCGAGGGTTTATCTTCAACATGGATGCTCAAGAACTTCGGGACACATACTATCGCGAAAGCGATGCT
CACAAAGCAATCAAGTCAACGTATGTCACGGATTTTGTGCCCAAGCAACCACCCACACCATCCAAGCAACTAGCG
ATGTCTTCAATTTTACGCAATCGCACGAAGAACATTTCCAAATGCATACCCGCGAGACTACGTATGTCGCGCCCG
CCCAAGGAAGTTCGATTTGTGGATGGTACCATTGATCCACAGCCGCGAAGTCGTATTGGCCTGGATGTGCCGAGA
CTTCTTGAGAGAGATTTAGACAGAGCTACGGACGATGATCCTCATGATCGTCCTTGGAACAGAGGCGAAGTGGCA
GGGACGGCAGTGTTCGACTGGCCGAGAGTTCCAGACATTGATTTGGAACGGTCGCGGACTCCCGAATGGACTCAG
CTCATACTCAAAGGGAAGTCTTGCTCCTTGTTGAAGACCCAGGAGACCTCGCCCATGCAGCGCATCCGTGAGCTG
GTTTCTAGCCCTACCGATCCTTGCTTGAAGTTTGAGGCTGGGCTTACAGATGAGGAATATCCTCATCGGGCGCGT
TTGTGGGCCGAAGAGGTTGAACGCATTGAAACCAAACAGCGAAAGAAAGAGGAAGCGGAGAGGCAGGCGGCGGCT
GAAGAAGCTGCGAGACAGGAGGCTGCGAGACAGGCTGCAGAGGAAGCGGCTAGACAAGCGGCTGAAGAGGCAGCT
GCCAAGCAAGCAGCAGAAGATGCTGCACAAAAACTGGCTGCTCGGTCAGGTCTCCTTCGCAGACCTCGAAAGCCT
CTTATCTCACCAGTCAGCGCCACGTGGTCCATCAAAGCTGAGAAAACAATGTCATCGAGTGCTGCAGTGTCGCAT
GCAAAGACTGGTGAGGGAAGCGACCTCAGACGCCACGACTTTGCCTCAGTCATTACTCCGACGAGATGGCTTAAC
GACGAGATCATCAATGGCACAATTATATGGATCGATCGGGCTGTTAATGAAGCTGCTGGTATTCAAGACACTCGA
CGTCAGACTCGCAAGTGTCTAGCAATGAACTCATTCTTTTTTAAGGATCTTCTGGCAAAGGGACCAGCGGGGACA
GACCGCAAACTGAGGCGCAACGGGGTTAACAAGAACAATTTCCTTGACGTGGAAACGATTCTTTTGCCTGTGTGC
GAACGGTCGCATTGGACCTTGATGGTGATTCGTCCCAAACACAGGACTGTGGCGCACATGGACTCTTTGAACCCG
GCTGGAGACGTGCGATATGCGAATTTGACAATGGAATGTGTCAAAAGTGTCTTGGAGGAAAGGTTTATAGCATCG
GACTGGAAAGTGGTACGTCATGAAGCGCCTCGACAAAGCAACGGATATGACTGCGGTGTCTTCACCATTACCAAT
GCTCTTTGCCTCGCACTTGGTCTGGACCCGGTTCTCAGTTACGAGGAAGGCGATTTGGAGGTGCAGAGGATGCGG
ATTGCTTGCGTGCTTTTGAACGAAGGATTCAAGGGGGATTTTGCCTTGGAGGGGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail