Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|333
Gene name
LocationContig_1072:1724..2640
Strand+
Gene length (bp)916
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17172 GST_N_4 Glutathione S-transferase N-terminal domain 5.9E-14 59 156
PF17171 GST_C_6 Glutathione S-transferase, C-terminal domain 1.1E-13 205 269
PF10568 Tom37 Outer mitochondrial membrane transport complex protein 2.4E-08 61 156

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HE00|MTX1_SCHPO Metaxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtx1 PE=3 SV=1 16 242 4.0E-15
sp|Q2TBS1|MTX1_BOVIN Metaxin-1 OS=Bos taurus GN=MTX1 PE=2 SV=1 45 278 5.0E-06
sp|Q3KPT9|MTX3_XENLA Metaxin-3 OS=Xenopus laevis GN=mtx3 PE=2 SV=2 51 238 7.0E-06

GO

GO Term Description Terminal node
GO:0001401 SAM complex Yes
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0005742 mitochondrial outer membrane translocase complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0098799 outer mitochondrial membrane protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|333
MASSHRWLPDAPSPVHALFRRFPLSVYDPSPLPGGPRADRPQLFIFTCRTGSDRPSFNPRCLKWQLWLRICGIDV
ETHASNPHASPNRSLPFLIPALNDSDPHSTITFSRIAAYARHHSSYQEPSVPSLRLDTYLSLFDQAIRPAWLHTL
YLVPENECLINVLFIPQSSLLRPSLLRNLRLEAHQSIISIHRHSRYSPDILLHNASKAFQALDKLLGSQDYFFDA
PSPTIFDATVFSYTHLILPNSSLHWIQNPLRPSLDDCHNLQRHRRLLYARYFPVKLDS*
Coding >OphauG2|333
ATGGCCTCTTCCCACCGCTGGCTCCCCGACGCCCCGTCCCCCGTCCACGCCCTCTTTCGTCGCTTTCCTCTGTCC
GTCTACGACCCCTCTCCTCTTCCCGGAGGGCCTCGTGCCGACCGGCCCCAGCTCTTCATCTTTACTTGTCGCACC
GGCTCCGACCGCCCCAGCTTCAACCCACGCTGCCTCAAGTGGCAGCTCTGGCTACGCATATGCGGCATTGACGTC
GAAACTCACGCCTCCAATCCCCATGCTTCGCCAAATCGCTCTCTGCCTTTTCTCATCCCCGCTCTCAACGACTCG
GACCCACACTCAACCATCACCTTTTCGCGTATAGCTGCCTATGCTCGCCACCACTCTTCTTACCAAGAACCCTCC
GTTCCCTCTCTTCGCTTGGACACGTATCTCTCTCTCTTTGACCAGGCCATTCGGCCCGCATGGCTCCATACTCTC
TACCTCGTTCCAGAAAACGAGTGCCTCATCAATGTTCTCTTTATTCCCCAGTCAAGCCTACTACGTCCCTCATTG
CTCCGCAATCTTCGCCTCGAGGCTCATCAGTCCATCATCTCCATCCATCGCCACTCCCGCTACAGTCCCGACATT
CTCCTCCACAATGCCTCAAAGGCTTTCCAGGCTCTCGACAAGCTTCTCGGCTCCCAAGACTACTTCTTTGATGCC
CCTTCACCAACAATCTTCGACGCCACCGTCTTCTCCTACACCCACTTGATTCTTCCCAACAGCTCTCTTCACTGG
ATACAAAATCCTCTTCGCCCCTCTCTCGACGACTGCCACAACTTGCAGCGTCACCGCAGACTCCTCTATGCTCGC
TACTTTCCCGTCAAGCTTGACTCATGA
Transcript >OphauG2|333
ATGGCCTCTTCCCACCGCTGGCTCCCCGACGCCCCGTCCCCCGTCCACGCCCTCTTTCGTCGCTTTCCTCTGTCC
GTCTACGACCCCTCTCCTCTTCCCGGAGGGCCTCGTGCCGACCGGCCCCAGCTCTTCATCTTTACTTGTCGCACC
GGCTCCGACCGCCCCAGCTTCAACCCACGCTGCCTCAAGTGGCAGCTCTGGCTACGCATATGCGGCATTGACGTC
GAAACTCACGCCTCCAATCCCCATGCTTCGCCAAATCGCTCTCTGCCTTTTCTCATCCCCGCTCTCAACGACTCG
GACCCACACTCAACCATCACCTTTTCGCGTATAGCTGCCTATGCTCGCCACCACTCTTCTTACCAAGAACCCTCC
GTTCCCTCTCTTCGCTTGGACACGTATCTCTCTCTCTTTGACCAGGCCATTCGGCCCGCATGGCTCCATACTCTC
TACCTCGTTCCAGAAAACGAGTGCCTCATCAATGTTCTCTTTATTCCCCAGTCAAGCCTACTACGTCCCTCATTG
CTCCGCAATCTTCGCCTCGAGGCTCATCAGTCCATCATCTCCATCCATCGCCACTCCCGCTACAGTCCCGACATT
CTCCTCCACAATGCCTCAAAGGCTTTCCAGGCTCTCGACAAGCTTCTCGGCTCCCAAGACTACTTCTTTGATGCC
CCTTCACCAACAATCTTCGACGCCACCGTCTTCTCCTACACCCACTTGATTCTTCCCAACAGCTCTCTTCACTGG
ATACAAAATCCTCTTCGCCCCTCTCTCGACGACTGCCACAACTTGCAGCGTCACCGCAGACTCCTCTATGCTCGC
TACTTTCCCGTCAAGCTTGACTCATGA
Gene >OphauG2|333
ATGGCCTCTTCCCACCGCTGGCTCCCCGACGCCCCGTCCCCCGTCCACGCCCTCTTTCGTCGCTTTCCTCTGTCC
GTCTACGACCCCTCTCCTCTTCCCGGAGGGCCTCGTGCCGACCGGCCCCAGCTCTTCATCTTTACTTGTCGCACC
GGCTCCGACCGCCCCAGCTTCAACCCACGCTGCCTCAAGTGGCAGCTCTGGCTACGCATATGCGGCATTGACGTC
GAAACTCACGCCTCCAATCCCCATGCTTCGCCAAATCGCTCTCTGCCTTTTCTCATCCCCGCTCTCAACGACTCG
GACCCACACTCAACCATCACCTTTTCGCGTATAGCTGCCTATGCTCGCCACCACTCTTCTTACCAAGAACCCTCC
GTTCCCTCTCTTCGCTTGGACACGTATCTCTCTCTCTTTGACCAGGCCATTCGGCCCGCATGGGTGAGTTGCACT
CGCCTCTGCCTCCTCCTCGTTCCGCCCGCGCTAACAATGCCTCTCATATTAGCTCCATACTCTCTACCTCGTTCC
AGAAAACGAGTGCCTCATCAATGTTCTCTTTATTCCCCAGTCAAGCCTACTACGTCCCTCATTGCTCCGCAATCT
TCGCCTCGAGGCTCATCAGTCCATCATCTCCATCCATCGCCACTCCCGCTACAGTCCCGACATTCTCCTCCACAA
TGCCTCAAAGGCTTTCCAGGCTCTCGACAAGCTTCTCGGCTCCCAAGACTACTTCTTTGATGCCCCTTCACCAAC
AATCTTCGACGCCACCGTCTTCTCCTACACCCACTTGATTCTTCCCAACAGCTCTCTTCACTGGATACAAAATCC
TCTTCGCCCCTCTCTCGACGACTGCCACAACTTGCAGCGTCACCGCAGACTCCTCTATGCTCGCTACTTTCCCGT
CAAGCTTGACTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail