Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3328
Gene name
LocationContig_25:22123..24243
Strand+
Gene length (bp)2120
Transcript length (bp)2055
Coding sequence length (bp)2055
Protein length (aa) 685

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 1.8E-21 513 650

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38148|PPS1_YEAST Dual specificity protein phosphatase PPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPS1 PE=3 SV=1 347 683 2.0E-49
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 504 664 7.0E-17
sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 507 653 3.0E-16
sp|Q13202|DUS8_HUMAN Dual specificity protein phosphatase 8 OS=Homo sapiens GN=DUSP8 PE=1 SV=2 507 653 3.0E-16
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 504 652 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38148|PPS1_YEAST Dual specificity protein phosphatase PPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPS1 PE=3 SV=1 347 683 2.0E-49
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 504 664 7.0E-17
sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 507 653 3.0E-16
sp|Q13202|DUS8_HUMAN Dual specificity protein phosphatase 8 OS=Homo sapiens GN=DUSP8 PE=1 SV=2 507 653 3.0E-16
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 504 652 5.0E-16
sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 504 652 6.0E-16
sp|Q64623|DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus GN=Dusp1 PE=1 SV=1 502 652 6.0E-16
sp|P28563|DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus GN=Dusp1 PE=1 SV=1 502 652 6.0E-16
sp|Q16690|DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens GN=DUSP5 PE=1 SV=2 502 652 1.0E-15
sp|O54838|DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus GN=Dusp5 PE=2 SV=1 502 652 1.0E-15
sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 502 660 1.0E-15
sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 502 652 1.0E-15
sp|Q99956|DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens GN=DUSP9 PE=1 SV=1 500 653 2.0E-15
sp|Q91790|DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis GN=dusp1-a PE=1 SV=1 502 652 3.0E-15
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 506 664 5.0E-15
sp|Q9PW71|DUS4_CHICK Dual specificity protein phosphatase 4 OS=Gallus gallus GN=DUSP4 PE=2 SV=1 502 658 8.0E-15
sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 504 652 1.0E-14
sp|Q05923|DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens GN=DUSP2 PE=1 SV=1 502 652 1.0E-14
sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 504 652 1.0E-14
sp|Q05922|DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus GN=Dusp2 PE=1 SV=2 502 652 1.0E-14
sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 504 664 1.0E-14
sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 502 652 1.0E-14
sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 504 652 1.0E-14
sp|Q13115|DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens GN=DUSP4 PE=1 SV=1 502 658 3.0E-14
sp|Q62767|DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus GN=Dusp4 PE=2 SV=1 502 658 4.0E-14
sp|Q8BFV3|DUS4_MOUSE Dual specificity protein phosphatase 4 OS=Mus musculus GN=Dusp4 PE=2 SV=1 502 658 5.0E-14
sp|O55737|123R_IIV6 Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 GN=IIV6-123R PE=3 SV=1 506 659 7.0E-14
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 498 656 7.0E-13
sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 507 653 8.0E-13
sp|Q8WYL5|SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens GN=SSH1 PE=1 SV=2 506 649 4.0E-12
sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 571 655 5.0E-12
sp|Q76I79|SSH1_MOUSE Protein phosphatase Slingshot homolog 1 OS=Mus musculus GN=Ssh1 PE=1 SV=1 506 649 7.0E-12
sp|Q76I76|SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens GN=SSH2 PE=1 SV=1 506 649 1.0E-11
sp|Q10038|VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans GN=vhp-1 PE=1 SV=2 513 668 1.0E-11
sp|Q556Y8|DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum GN=DDB_G0273199 PE=3 SV=1 506 652 1.0E-11
sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 513 653 2.0E-11
sp|Q5SW75|SSH2_MOUSE Protein phosphatase Slingshot homolog 2 OS=Mus musculus GN=Ssh2 PE=1 SV=2 506 649 2.0E-11
sp|Q99N11|DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus GN=Dusp22 PE=1 SV=1 503 651 2.0E-11
sp|Q6B8I0|DS13A_MOUSE Dual specificity protein phosphatase 13 isoform A OS=Mus musculus GN=Dusp13 PE=2 SV=1 513 658 6.0E-11
sp|Q6B8I1|DS13A_HUMAN Dual specificity protein phosphatase 13 isoform A OS=Homo sapiens GN=DUSP13 PE=1 SV=1 513 658 7.0E-11
sp|Q6NN85|SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster GN=ssh PE=1 SV=2 506 645 2.0E-10
sp|Q9NRW4|DUS22_HUMAN Dual specificity protein phosphatase 22 OS=Homo sapiens GN=DUSP22 PE=1 SV=1 503 651 3.0E-10
sp|Q0IID7|DUS10_BOVIN Dual specificity protein phosphatase 10 OS=Bos taurus GN=DUSP10 PE=2 SV=1 509 661 4.0E-10
sp|Q9JLY7|DUS14_MOUSE Dual specificity protein phosphatase 14 OS=Mus musculus GN=Dusp14 PE=2 SV=2 495 657 6.0E-10
sp|Q9Y6W6|DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens GN=DUSP10 PE=1 SV=1 509 661 7.0E-10
sp|Q9ESS0|DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus GN=Dusp10 PE=2 SV=2 509 661 7.0E-10
sp|Q8R4V2|DUS15_MOUSE Dual specificity protein phosphatase 15 OS=Mus musculus GN=Dusp15 PE=2 SV=3 503 671 8.0E-10
sp|Q1LWL2|DS22A_DANRE Dual specificity protein phosphatase 22-A OS=Danio rerio GN=dusp22a PE=2 SV=2 503 649 1.0E-09
sp|O95147|DUS14_HUMAN Dual specificity protein phosphatase 14 OS=Homo sapiens GN=DUSP14 PE=1 SV=1 495 652 3.0E-09
sp|Q17QM8|DUS14_BOVIN Dual specificity protein phosphatase 14 OS=Bos taurus GN=DUSP14 PE=2 SV=1 495 652 3.0E-09
sp|Q60969|STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus GN=Styx PE=1 SV=2 559 649 4.0E-09
sp|Q9D0T2|DUS12_MOUSE Dual specificity protein phosphatase 12 OS=Mus musculus GN=Dusp12 PE=2 SV=1 513 654 5.0E-09
sp|Q9JIM4|DUS12_RAT Dual specificity protein phosphatase 12 OS=Rattus norvegicus GN=Dusp12 PE=2 SV=1 513 623 5.0E-09
sp|Q566R7|DS22B_DANRE Dual specificity protein phosphatase 22-B OS=Danio rerio GN=dusp22b PE=2 SV=2 503 630 6.0E-09
sp|Q6IVY4|SSH_XENLA Protein phosphatase Slingshot homolog OS=Xenopus laevis GN=ssh PE=1 SV=2 506 649 1.0E-08
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 505 652 1.0E-08
sp|Q6AXW7|DUS18_RAT Dual specificity protein phosphatase 18 OS=Rattus norvegicus GN=Dusp18 PE=2 SV=1 507 657 2.0E-08
sp|Q54R42|DUSP2_DICDI Probable dual specificity protein phosphatase DDB_G0283417 OS=Dictyostelium discoideum GN=DDB_G0283417 PE=3 SV=1 513 652 2.0E-08
sp|Q9BV47|DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens GN=DUSP26 PE=1 SV=1 513 654 3.0E-08
sp|Q5R6H6|DUS26_PONAB Dual specificity protein phosphatase 26 OS=Pongo abelii GN=DUSP26 PE=2 SV=1 513 654 3.0E-08
sp|Q5XHB2|DUS22_XENTR Dual specificity protein phosphatase 22 OS=Xenopus tropicalis GN=dusp22 PE=2 SV=1 503 651 4.0E-08
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 505 654 4.0E-08
sp|Q4V7N3|STYXA_XENLA Serine/threonine/tyrosine-interacting protein A OS=Xenopus laevis GN=styx-a PE=2 SV=1 559 649 4.0E-08
sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 497 650 4.0E-08
sp|Q5U593|STYXB_XENLA Serine/threonine/tyrosine-interacting protein B OS=Xenopus laevis GN=styx-b PE=2 SV=1 559 649 5.0E-08
sp|Q5RDP3|STYX_PONAB Serine/threonine/tyrosine-interacting protein OS=Pongo abelii GN=STYX PE=2 SV=1 559 649 5.0E-08
sp|Q8WUJ0|STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens GN=STYX PE=1 SV=1 559 649 5.0E-08
sp|Q9D700|DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus GN=Dusp26 PE=2 SV=2 513 654 6.0E-08
sp|Q5FVI9|DUS26_RAT Dual specificity protein phosphatase 26 OS=Rattus norvegicus GN=Dusp26 PE=2 SV=1 513 654 8.0E-08
sp|Q6GQJ8|DUS22_XENLA Dual specificity protein phosphatase 22 OS=Xenopus laevis GN=dusp22 PE=2 SV=1 503 645 1.0E-07
sp|Q17QJ3|DUS26_BOVIN Dual specificity protein phosphatase 26 OS=Bos taurus GN=DUSP26 PE=2 SV=1 513 654 1.0E-07
sp|Q9UNI6|DUS12_HUMAN Dual specificity protein phosphatase 12 OS=Homo sapiens GN=DUSP12 PE=1 SV=1 513 654 1.0E-07
sp|Q8BTR5|DUS28_MOUSE Dual specificity phosphatase 28 OS=Mus musculus GN=Dusp28 PE=1 SV=1 507 653 2.0E-07
sp|Q8K330|SSH3_MOUSE Protein phosphatase Slingshot homolog 3 OS=Mus musculus GN=Ssh3 PE=1 SV=1 507 664 3.0E-07
sp|Q5RD73|DUS3_PONAB Dual specificity protein phosphatase 3 OS=Pongo abelii GN=DUSP3 PE=2 SV=1 504 652 4.0E-07
sp|P51452|DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens GN=DUSP3 PE=1 SV=1 504 652 4.0E-07
sp|Q5XIS1|SSH3_RAT Protein phosphatase Slingshot homolog 3 OS=Rattus norvegicus GN=Ssh3 PE=1 SV=1 507 664 5.0E-07
sp|Q9D7X3|DUS3_MOUSE Dual specificity protein phosphatase 3 OS=Mus musculus GN=Dusp3 PE=1 SV=1 483 652 1.0E-06
sp|Q9D9D8|DUS21_MOUSE Dual specificity phosphatase 21 OS=Mus musculus GN=Dusp21 PE=1 SV=1 507 657 3.0E-06
sp|Q8NEJ0|DUS18_HUMAN Dual specificity protein phosphatase 18 OS=Homo sapiens GN=DUSP18 PE=1 SV=1 507 657 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0006793 phosphorus metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0004721 phosphoprotein phosphatase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2695
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3328 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2497
Ophiocordyceps camponoti-floridani Ophcf2|04283
Ophiocordyceps camponoti-rufipedis Ophun1|2101
Ophiocordyceps kimflemingae Ophio5|8237
Ophiocordyceps subramaniannii Hirsu2|4205

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3328
MATLALTRPAMAARASAPDVATVMTPPHSLSNKHQSEPPAGPTASKATTCTPPPSPTTLDAVAQTSLLYPPHGYS
RIDADSLSVYELNADQVASALDYAARQPLPPPSSVFPWLHGLHPDNQLQQAFFAGHSSTPATIPAHLRGVVLVKA
DGQLDVACLKGAIAPNDFIRRGTPTEFVNVDPPDGFSVRNFQIQPAKMAFTSDIIVYDAQNLDEVRKLAWDIAAA
QLHWHAQHAAKGHHLPHYHTFVCTSPLSEFEQRHPHLVSVDATGTVTGKVLSFSQQERNEMWNMAEASQISYNVF
MGPTPEPGSSEEESFDMLVECSDLGRLNPSALRSLVEDPNGENLGRISLDFPSSGSILPPAWSHEEADGILETCR
WLFHLAHGTCPAVQNSHGLPQSCNPPTPTVRQRRPRKILIHCTDGYTESTLLGIAYLSYSAGIPVPEAWLRLHTC
KHRDFFAYPTDVALLTAIATRLLQESPASAGRSLHDITNMVKDEPRWLQGLDGSLPSRILNYLYLGNLGHANNPH
LLANLGIKQVLSVGETALWRDADKDDWGAENICVVQGVQDNGIDSLTDHFARCLEFIDRGRRNGTATLVHCRVGV
SRSATICIAEVMRSLNLSFPRAYCFVRARRLNVIIQPHLRFVYELLRWEEHLRQTNSSYTPTQREMEWGEIAHEI
ALINRPYSR*
Coding >OphauG2|3328
ATGGCTACCCTCGCTCTGACGAGGCCGGCAATGGCTGCTCGCGCTTCAGCGCCAGACGTGGCGACTGTCATGACC
CCGCCGCATTCGCTATCCAACAAGCATCAATCCGAACCCCCTGCTGGCCCCACTGCCTCCAAGGCGACGACGTGC
ACTCCGCCTCCCTCGCCGACAACACTGGACGCTGTTGCCCAGACCTCTTTGCTTTATCCTCCCCATGGCTATTCC
CGCATCGACGCCGACTCTCTGTCGGTATACGAGCTCAACGCGGACCAGGTTGCCAGCGCTCTCGACTATGCCGCC
CGCCAGCCCCTCCCCCCGCCGTCCTCAGTCTTTCCCTGGCTCCACGGCCTGCATCCTGACAACCAACTCCAACAG
GCCTTTTTTGCCGGCCATTCCTCAACCCCCGCAACAATCCCAGCCCATCTTCGAGGCGTTGTCCTTGTCAAGGCC
GATGGCCAACTCGACGTGGCATGCCTCAAGGGCGCCATAGCACCCAATGACTTTATCCGCCGCGGCACTCCTACT
GAGTTTGTCAATGTCGACCCTCCTGATGGCTTCTCGGTCCGCAATTTCCAAATCCAGCCTGCAAAAATGGCTTTT
ACTTCGGACATCATCGTCTATGATGCCCAAAACCTCGACGAGGTCCGCAAGCTGGCATGGGATATAGCCGCCGCT
CAGCTACACTGGCACGCCCAACATGCCGCCAAAGGGCACCATTTGCCGCACTATCATACTTTTGTCTGCACAAGC
CCACTCTCCGAGTTTGAGCAGCGACACCCTCATCTCGTCTCTGTCGATGCTACGGGTACCGTGACGGGCAAGGTT
CTCAGCTTTAGCCAGCAGGAGAGAAATGAAATGTGGAATATGGCTGAGGCGTCTCAAATTTCTTACAATGTCTTC
ATGGGCCCGACGCCTGAGCCCGGCAGCTCTGAAGAAGAGTCCTTCGATATGCTCGTCGAATGTAGTGACCTGGGC
CGCTTGAATCCGTCAGCTCTACGGTCCTTGGTTGAGGATCCCAATGGCGAAAACCTTGGCCGCATATCCCTCGAC
TTCCCTTCATCCGGAAGTATCTTGCCTCCAGCTTGGTCTCACGAGGAGGCTGATGGCATCCTCGAAACTTGTCGC
TGGCTATTCCACCTTGCACATGGAACGTGTCCAGCAGTGCAGAATTCCCACGGCTTGCCTCAGTCCTGCAACCCA
CCCACGCCAACGGTGAGACAACGGCGACCACGCAAGATACTCATACACTGCACAGACGGTTATACCGAATCAACT
CTGTTGGGCATTGCCTATCTCAGCTATAGCGCAGGTATTCCAGTTCCCGAAGCGTGGCTCAGGCTTCACACATGC
AAGCATCGCGATTTCTTCGCGTATCCAACCGATGTGGCATTGCTCACCGCCATTGCCACCCGTCTTTTGCAAGAG
TCGCCCGCTAGCGCGGGCCGTAGTCTTCATGACATTACAAACATGGTCAAGGATGAGCCCCGGTGGCTCCAGGGC
TTGGATGGCTCCTTACCAAGCAGGATTTTGAATTACCTTTACCTTGGAAACTTGGGGCATGCCAACAACCCCCAT
CTCCTTGCCAATCTCGGAATAAAACAGGTGCTCAGTGTTGGAGAGACGGCTCTATGGCGAGACGCCGACAAGGAC
GACTGGGGCGCGGAAAATATATGTGTTGTGCAAGGGGTGCAAGACAATGGCATAGACTCGTTGACGGACCACTTT
GCTCGATGCCTTGAGTTTATTGATCGAGGCAGACGCAACGGCACGGCCACATTGGTGCATTGTCGGGTAGGCGTC
TCTCGCAGCGCAACCATTTGCATTGCAGAGGTGATGCGCTCTCTCAACTTGTCCTTTCCTCGTGCCTATTGCTTC
GTTAGGGCCCGGCGGCTCAATGTCATAATCCAGCCTCACCTACGCTTTGTTTATGAACTATTGAGATGGGAAGAG
CACCTTCGGCAGACCAACTCGTCTTATACACCTACTCAGAGAGAGATGGAATGGGGAGAAATTGCCCATGAAATT
GCCCTCATCAACCGCCCTTATTCTAGATGA
Transcript >OphauG2|3328
ATGGCTACCCTCGCTCTGACGAGGCCGGCAATGGCTGCTCGCGCTTCAGCGCCAGACGTGGCGACTGTCATGACC
CCGCCGCATTCGCTATCCAACAAGCATCAATCCGAACCCCCTGCTGGCCCCACTGCCTCCAAGGCGACGACGTGC
ACTCCGCCTCCCTCGCCGACAACACTGGACGCTGTTGCCCAGACCTCTTTGCTTTATCCTCCCCATGGCTATTCC
CGCATCGACGCCGACTCTCTGTCGGTATACGAGCTCAACGCGGACCAGGTTGCCAGCGCTCTCGACTATGCCGCC
CGCCAGCCCCTCCCCCCGCCGTCCTCAGTCTTTCCCTGGCTCCACGGCCTGCATCCTGACAACCAACTCCAACAG
GCCTTTTTTGCCGGCCATTCCTCAACCCCCGCAACAATCCCAGCCCATCTTCGAGGCGTTGTCCTTGTCAAGGCC
GATGGCCAACTCGACGTGGCATGCCTCAAGGGCGCCATAGCACCCAATGACTTTATCCGCCGCGGCACTCCTACT
GAGTTTGTCAATGTCGACCCTCCTGATGGCTTCTCGGTCCGCAATTTCCAAATCCAGCCTGCAAAAATGGCTTTT
ACTTCGGACATCATCGTCTATGATGCCCAAAACCTCGACGAGGTCCGCAAGCTGGCATGGGATATAGCCGCCGCT
CAGCTACACTGGCACGCCCAACATGCCGCCAAAGGGCACCATTTGCCGCACTATCATACTTTTGTCTGCACAAGC
CCACTCTCCGAGTTTGAGCAGCGACACCCTCATCTCGTCTCTGTCGATGCTACGGGTACCGTGACGGGCAAGGTT
CTCAGCTTTAGCCAGCAGGAGAGAAATGAAATGTGGAATATGGCTGAGGCGTCTCAAATTTCTTACAATGTCTTC
ATGGGCCCGACGCCTGAGCCCGGCAGCTCTGAAGAAGAGTCCTTCGATATGCTCGTCGAATGTAGTGACCTGGGC
CGCTTGAATCCGTCAGCTCTACGGTCCTTGGTTGAGGATCCCAATGGCGAAAACCTTGGCCGCATATCCCTCGAC
TTCCCTTCATCCGGAAGTATCTTGCCTCCAGCTTGGTCTCACGAGGAGGCTGATGGCATCCTCGAAACTTGTCGC
TGGCTATTCCACCTTGCACATGGAACGTGTCCAGCAGTGCAGAATTCCCACGGCTTGCCTCAGTCCTGCAACCCA
CCCACGCCAACGGTGAGACAACGGCGACCACGCAAGATACTCATACACTGCACAGACGGTTATACCGAATCAACT
CTGTTGGGCATTGCCTATCTCAGCTATAGCGCAGGTATTCCAGTTCCCGAAGCGTGGCTCAGGCTTCACACATGC
AAGCATCGCGATTTCTTCGCGTATCCAACCGATGTGGCATTGCTCACCGCCATTGCCACCCGTCTTTTGCAAGAG
TCGCCCGCTAGCGCGGGCCGTAGTCTTCATGACATTACAAACATGGTCAAGGATGAGCCCCGGTGGCTCCAGGGC
TTGGATGGCTCCTTACCAAGCAGGATTTTGAATTACCTTTACCTTGGAAACTTGGGGCATGCCAACAACCCCCAT
CTCCTTGCCAATCTCGGAATAAAACAGGTGCTCAGTGTTGGAGAGACGGCTCTATGGCGAGACGCCGACAAGGAC
GACTGGGGCGCGGAAAATATATGTGTTGTGCAAGGGGTGCAAGACAATGGCATAGACTCGTTGACGGACCACTTT
GCTCGATGCCTTGAGTTTATTGATCGAGGCAGACGCAACGGCACGGCCACATTGGTGCATTGTCGGGTAGGCGTC
TCTCGCAGCGCAACCATTTGCATTGCAGAGGTGATGCGCTCTCTCAACTTGTCCTTTCCTCGTGCCTATTGCTTC
GTTAGGGCCCGGCGGCTCAATGTCATAATCCAGCCTCACCTACGCTTTGTTTATGAACTATTGAGATGGGAAGAG
CACCTTCGGCAGACCAACTCGTCTTATACACCTACTCAGAGAGAGATGGAATGGGGAGAAATTGCCCATGAAATT
GCCCTCATCAACCGCCCTTATTCTAGATGA
Gene >OphauG2|3328
ATGGCTACCCTCGCTCTGACGAGGCCGGCAATGGCTGCTCGCGCTTCAGCGCCAGACGTGGCGACTGTCATGACC
CCGCCGCATTCGCTATCCAACAAGCATCAATCCGAACCCCCTGCTGGCCCCACTGCCTCCAAGGCGACGACGTGC
ACTCCGCCTCCCTCGCCGACAACACTGGACGCTGTTGCCCAGACCTCTTTGCTTTATCCTCCCCATGGCTATTCC
CGCATCGACGCCGACTCTCTGTCGGTATACGAGCTCAACGCGGACCAGGTTGCCAGCGCTCTCGACTATGCCGCC
CGCCAGCCCCTCCCCCCGCCGTCCTCAGTCTTTCCCTGGCTCCACGGCCTGCATCCTGACAACCAACTCCAACAG
GCCTTTTTTGCCGGCCATTCCTCAACCCCCGCAACAATCCCAGCCCATCTTCGAGGCGTTGTCCTTGTCAAGGCC
GATGGCCAACTCGACGTGGCATGCCTCAAGGGCGCCATAGCACCCAATGACTTTATCCGCCGCGGCACTCCTACT
GAGTTTGTCAATGTCGACCCTCCTGATGGCTTCTCGGTCCGCAATTTCCAAATCCAGCCTGCAAAAATGGCTTTT
ACTTCGGACATCATCGTCTATGATGCCCAAAACCTCGACGAGGTCCGCAAGCTGGCATGGGATATAGCCGCCGCT
CAGCTACACTGGCACGCCCAACATGCCGCCAAAGGGCACCATTTGCCGCACTATCATACTTTTGTCTGCACAAGC
CCACTCTCCGAGTTTGAGCAGCGACACCCTCATCTCGTCTCTGTCGATGCTACGGGTACCGTGACGGGCAAGGTT
CTCAGCTTTAGCCAGCAGGAGAGAAATGAAATGTGGAATATGGCTGAGGCGTCTCAAATTTCTTACAATGTCTTC
ATGGGCCCGACGCCTGAGCCCGGCAGCTCTGAAGAAGAGTCCTTCGATATGCTCGTCGAATGTAGTGACCTGGGC
CGCTTGAATCCGTCAGCTCTACGGTCCTTGGTTGAGGATCCCAATGGCGAAAACCTTGGCCGCATATCCCTCGAC
TTCCCTTCATCCGGAAGTATCTTGCCTCCAGCTTGGTCTCACGAGGAGGCTGATGGCATCCTCGAAACTTGTCGC
TGGCTATTCCACCTTGCACATGGAACGTGTCCAGCAGTGCAGAATTCCCACGGCTTGCCTCAGTCCTGCAACCCA
CCCACGCCAACGGTGAGACAACGGCGACCACGCAAGATACTCATACACTGCACAGACGGTTATACCGAATCAACT
CTGTTGGGCATTGCCTATCTCAGCTATAGCGCAGGTATTCCAGTTCCCGAAGCGTGGCTCAGGCTTCACACATGC
AAGCATCGCGATTTCTTCGCGTATCCAACCGATGTGGCATTGCTCACCGCCATTGCCACCCGTCTTTTGCAAGAG
TCGCCCGCTAGCGCGGGCCGTAGTCTTCATGACATTACAAACATGGTCAAGGATGAGCCCCGGTGGCTCCAGGGC
TTGGATGGCTCCTTACCAAGCAGGATTTTGAATTACCTTTACCTTGGAAACTTGGGGCATGCCAACAACCCCCAT
CTCCTTGCCAATCTCGGAATAAAACAGGTGCTCAGTGTTGGAGAGACGGCTCTATGGCGAGACGCCGACAAGGAC
GACTGGGGCGCGGAAAATATATGTGTTGTGCAAGGGGTGCAAGACAATGGCATAGACTCGTTGACGGACCACTTT
GCTCGATGCCTTGAGTTTATTGGTAAGTTGTGGCCTTCCACTACCCATTGTCTTGTGTCAGAAATGCTCATCGTC
TTGCCATGCCAGATCGAGGCAGACGCAACGGCACGGCCACATTGGTGCATTGTCGGGTAGGCGTCTCTCGCAGCG
CAACCATTTGCATTGCAGAGGTGATGCGCTCTCTCAACTTGTCCTTTCCTCGTGCCTATTGCTTCGTTAGGGCCC
GGCGGCTCAATGTCATAATCCAGCCTCACCTACGCTTTGTTTATGAACTATTGAGATGGGAAGAGCACCTTCGGC
AGACCAACTCGTCTTATACACCTACTCAGAGAGAGATGGAATGGGGAGAAATTGCCCATGAAATTGCCCTCATCA
ACCGCCCTTATTCTAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail