Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3321
Gene name
LocationContig_25:1493..3420
Strand-
Gene length (bp)1927
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.1E-02 491 516
PF00096 zf-C2H2 Zinc finger, C2H2 type 9.7E-03 581 605

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y815|RSV2_SCHPO Zinc finger protein rsv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv2 PE=3 SV=1 535 605 3.0E-17
sp|Q59VM4|RPN4_CANAL Transcriptional regulator RPN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPN4 PE=1 SV=1 542 605 1.0E-16
sp|Q03465|RPN4_YEAST Protein RPN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN4 PE=1 SV=1 544 614 2.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3321 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2490
Ophiocordyceps camponoti-rufipedis Ophun1|2097
Ophiocordyceps kimflemingae Ophio5|862
Ophiocordyceps subramaniannii Hirsu2|4709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3321
MISLLPQSDRYSIAALHHHYNFATYPQDQKYSAPALYPPAPDSLPDSPLSFIDPPNSQLDLPAAKQEDLGHAVTG
APPEGKTLRKPESMQMQPDAWSASSSGRYSHKRDLSSSTQASAGPASPASACSTFPQIVTTDSSRSSIDDIHSPD
DYYHHQLGPKPMPSWPGYHNGLDGSLHGMAYPVAAPAVHKKQMLPAQSMGGRPHTESAHEASCTPRFGMSSNNKR
SALANINVPKLDRTMTDVYGDELYSPNFAITSTSPSQSHLAPSPVSNQGGHARHASENDVFSQRISAANNQHLSV
AHTPLSRNRSPFRTGSPLAPVPVVHDSQAAFCAAFASSQRIGEQEATHDEGLVDFGNMDSETPKTMSPQDAVLEF
SDPDADSAIPLFSPGPSFTGTLDTLHSTKNVPSDAGGNSDMGIQSASLAPAISMSSHMTPDYRDAGDANHPILDN
GQVSALDSPPLLSSSGSSSRESRSKTPVRSSAPRPYEGGTYTCTYHGCTMRFETPWLLQKHKREGHRQPQGLVPN
SRDVSAAVVFNTQAGPHRCDRINPSTGKSCNTVFSRPYDLTRHEDTIHNARKQKVRCDLCSEDKTFSRADALTRH
YRVCHPDVALPGKHRRRGGL*
Coding >OphauG2|3321
ATGATCTCGCTTCTGCCTCAGTCGGACCGATACTCGATTGCCGCCCTTCACCACCACTACAACTTTGCGACATAC
CCACAGGATCAGAAATATTCGGCGCCTGCCCTCTACCCACCTGCTCCCGACTCGTTGCCTGATTCTCCTCTGTCT
TTTATCGACCCGCCCAATTCGCAGTTGGATTTGCCTGCCGCCAAGCAAGAAGACCTTGGCCACGCTGTGACGGGT
GCGCCCCCCGAGGGCAAGACACTCAGAAAGCCCGAGTCGATGCAGATGCAGCCTGATGCGTGGTCCGCCTCCAGC
AGTGGCCGCTATTCCCACAAGAGAGACCTGTCCTCGTCCACTCAAGCTTCTGCCGGTCCTGCCTCTCCAGCCAGC
GCCTGCTCTACCTTTCCTCAAATAGTCACCACCGATTCAAGCAGAAGCAGTATCGACGACATTCATTCTCCAGAT
GATTATTACCACCATCAACTCGGCCCCAAGCCCATGCCAAGTTGGCCCGGTTATCACAACGGCCTCGACGGCTCC
TTGCATGGCATGGCCTACCCGGTTGCCGCACCGGCAGTCCATAAGAAGCAGATGCTACCCGCGCAGAGCATGGGC
GGTCGACCGCATACCGAGTCAGCCCATGAAGCGTCTTGCACTCCTAGATTTGGTATGAGTTCAAATAACAAAAGG
AGTGCACTCGCAAACATCAACGTTCCCAAGTTGGATCGCACCATGACTGATGTGTACGGCGACGAATTATATAGC
CCCAACTTTGCCATAACTTCCACCTCGCCATCGCAGTCGCATCTCGCGCCCTCCCCTGTGAGCAATCAGGGCGGC
CATGCAAGGCACGCCAGCGAAAATGATGTTTTCAGCCAGCGGATTAGTGCGGCCAACAACCAGCACCTGAGCGTC
GCACATACGCCTCTCTCACGCAACAGGTCTCCGTTCCGAACAGGGTCACCATTGGCCCCAGTGCCTGTTGTGCAC
GATTCCCAGGCAGCATTTTGTGCAGCGTTTGCTTCATCACAGCGCATTGGGGAGCAGGAAGCTACCCACGATGAA
GGCCTTGTGGACTTTGGCAACATGGATTCAGAGACTCCAAAAACAATGTCTCCACAAGACGCCGTCCTCGAATTC
AGCGACCCCGATGCTGACAGCGCCATACCTCTCTTTTCCCCTGGCCCTAGTTTTACTGGTACCCTGGACACTCTC
CACTCCACCAAGAATGTTCCCTCCGATGCAGGAGGCAATTCCGACATGGGAATTCAGTCCGCATCCTTAGCCCCG
GCCATCTCCATGTCTTCACACATGACCCCGGACTATAGAGATGCAGGCGATGCAAACCACCCCATTCTAGACAAT
GGGCAAGTCAGCGCCCTCGATAGCCCTCCACTGCTCAGTTCTTCTGGCTCTAGCTCCAGAGAGTCTCGAAGCAAG
ACACCTGTCAGAAGCAGTGCACCACGGCCTTACGAAGGTGGTACATATACGTGCACATATCACGGCTGCACCATG
AGATTTGAGACGCCATGGCTCCTACAGAAACACAAGAGGGAAGGGCACCGGCAACCGCAAGGCCTGGTCCCCAAT
TCTCGTGATGTCTCTGCGGCAGTCGTGTTCAATACTCAGGCTGGGCCCCATCGCTGCGACCGTATCAACCCCAGC
ACAGGGAAGTCATGCAATACAGTATTTTCGAGACCGTACGACTTGACTCGCCATGAAGACACGATACACAATGCA
AGGAAGCAAAAAGTGCGCTGCGACTTGTGTTCTGAAGACAAGACTTTTAGCCGCGCCGATGCACTGACCCGGCAC
TATCGTGTGTGCCATCCCGACGTGGCACTGCCTGGCAAGCATCGACGTCGCGGCGGACTCTAA
Transcript >OphauG2|3321
ATGATCTCGCTTCTGCCTCAGTCGGACCGATACTCGATTGCCGCCCTTCACCACCACTACAACTTTGCGACATAC
CCACAGGATCAGAAATATTCGGCGCCTGCCCTCTACCCACCTGCTCCCGACTCGTTGCCTGATTCTCCTCTGTCT
TTTATCGACCCGCCCAATTCGCAGTTGGATTTGCCTGCCGCCAAGCAAGAAGACCTTGGCCACGCTGTGACGGGT
GCGCCCCCCGAGGGCAAGACACTCAGAAAGCCCGAGTCGATGCAGATGCAGCCTGATGCGTGGTCCGCCTCCAGC
AGTGGCCGCTATTCCCACAAGAGAGACCTGTCCTCGTCCACTCAAGCTTCTGCCGGTCCTGCCTCTCCAGCCAGC
GCCTGCTCTACCTTTCCTCAAATAGTCACCACCGATTCAAGCAGAAGCAGTATCGACGACATTCATTCTCCAGAT
GATTATTACCACCATCAACTCGGCCCCAAGCCCATGCCAAGTTGGCCCGGTTATCACAACGGCCTCGACGGCTCC
TTGCATGGCATGGCCTACCCGGTTGCCGCACCGGCAGTCCATAAGAAGCAGATGCTACCCGCGCAGAGCATGGGC
GGTCGACCGCATACCGAGTCAGCCCATGAAGCGTCTTGCACTCCTAGATTTGGTATGAGTTCAAATAACAAAAGG
AGTGCACTCGCAAACATCAACGTTCCCAAGTTGGATCGCACCATGACTGATGTGTACGGCGACGAATTATATAGC
CCCAACTTTGCCATAACTTCCACCTCGCCATCGCAGTCGCATCTCGCGCCCTCCCCTGTGAGCAATCAGGGCGGC
CATGCAAGGCACGCCAGCGAAAATGATGTTTTCAGCCAGCGGATTAGTGCGGCCAACAACCAGCACCTGAGCGTC
GCACATACGCCTCTCTCACGCAACAGGTCTCCGTTCCGAACAGGGTCACCATTGGCCCCAGTGCCTGTTGTGCAC
GATTCCCAGGCAGCATTTTGTGCAGCGTTTGCTTCATCACAGCGCATTGGGGAGCAGGAAGCTACCCACGATGAA
GGCCTTGTGGACTTTGGCAACATGGATTCAGAGACTCCAAAAACAATGTCTCCACAAGACGCCGTCCTCGAATTC
AGCGACCCCGATGCTGACAGCGCCATACCTCTCTTTTCCCCTGGCCCTAGTTTTACTGGTACCCTGGACACTCTC
CACTCCACCAAGAATGTTCCCTCCGATGCAGGAGGCAATTCCGACATGGGAATTCAGTCCGCATCCTTAGCCCCG
GCCATCTCCATGTCTTCACACATGACCCCGGACTATAGAGATGCAGGCGATGCAAACCACCCCATTCTAGACAAT
GGGCAAGTCAGCGCCCTCGATAGCCCTCCACTGCTCAGTTCTTCTGGCTCTAGCTCCAGAGAGTCTCGAAGCAAG
ACACCTGTCAGAAGCAGTGCACCACGGCCTTACGAAGGTGGTACATATACGTGCACATATCACGGCTGCACCATG
AGATTTGAGACGCCATGGCTCCTACAGAAACACAAGAGGGAAGGGCACCGGCAACCGCAAGGCCTGGTCCCCAAT
TCTCGTGATGTCTCTGCGGCAGTCGTGTTCAATACTCAGGCTGGGCCCCATCGCTGCGACCGTATCAACCCCAGC
ACAGGGAAGTCATGCAATACAGTATTTTCGAGACCGTACGACTTGACTCGCCATGAAGACACGATACACAATGCA
AGGAAGCAAAAAGTGCGCTGCGACTTGTGTTCTGAAGACAAGACTTTTAGCCGCGCCGATGCACTGACCCGGCAC
TATCGTGTGTGCCATCCCGACGTGGCACTGCCTGGCAAGCATCGACGTCGCGGCGGACTCTAA
Gene >OphauG2|3321
ATGATCTCGCTTCTGCCTCAGTCGGACCGATACTCGATTGCCGCCCTTCACCACCACTACAACTTTGCGACATAC
CCACAGGATCAGAAATATTCGGCGCCTGCCCTCTACCCACCTGCTCCCGACTCGTTGCCTGATTCTCCTCTGTCT
TTTATCGACCCGCCCAATTCGCAGTTGGATTTGCCTGCCGCCAAGCAAGAAGACCTTGGCCACGCTGTGACGGGT
GCGCCCCCCGAGGGCAAGACACTCAGAAAGCCCGAGTCGATGCAGATGCAGCCTGATGCGTGGTCCGCCTCCAGC
AGTGGCCGCTATTCCCACAAGAGAGACCTGTCCTCGTCCACTCAAGCTTCTGCCGGTCCTGCCTCTCCAGCCAGC
GCCTGCTCTACCTTTCCTCAAATAGTCACCACCGATTCAAGCAGAAGCAGTATCGACGACATTCATTCTCCAGAT
GATTATTACCACCATCAACTCGGCCCCAAGCCCATGCCAAGTTGGCCCGGTTATCACAACGGCCTCGACGGCTCC
TTGCATGGCATGGCCTACCCGGTTGCCGCACCGGCAGTCCATAAGAAGCAGATGCTACCCGCGCAGAGCATGGGC
GGTCGACCGCATACCGAGTCAGCCCATGAAGCGTCTTGCACTCCTAGATTTGGTATGAGTTCAAATAACAAAAGG
AGTGGTATGTACTCTTAATTTTCTTGTATCAATACCTCTCTCCCTGTCTTGCTAATCTCATATACCAGCACTCGC
AAACATCAACGTTCCCAAGTTGGATCGCACCATGACTGATGTGTACGGCGACGAATTATATAGCCCCAACTTTGC
CATAACTTCCACCTCGCCATCGCAGTCGCATCTCGCGCCCTCCCCTGTGAGCAATCAGGGCGGCCATGCAAGGCA
CGCCAGCGAAAATGATGTTTTCAGCCAGCGGATTAGTGCGGCCAACAACCAGCACCTGAGCGTCGCACATACGCC
TCTCTCACGCAACAGGTCTCCGTTCCGAACAGGGTCACCATTGGCCCCAGTGCCTGTTGTGCACGATTCCCAGGC
AGCATTTTGTGCAGCGTTTGCTTCATCACAGCGCATTGGGGAGCAGGAAGCTACCCACGATGAAGGCCTTGTGGA
CTTTGGCAACATGGATTCAGAGACTCCAAAAACAATGTCTCCACAAGACGCCGTCCTCGAATTCAGCGACCCCGA
TGCTGACAGCGCCATACCTCTCTTTTCCCCTGGCCCTAGTTTTACTGGTACCCTGGACACTCTCCACTCCACCAA
GAATGTTCCCTCCGATGCAGGAGGCAATTCCGACATGGGAATTCAGTCCGCATCCTTAGCCCCGGCCATCTCCAT
GTCTTCACACATGACCCCGGACTATAGAGATGCAGGCGATGCAAACCACCCCATTCTAGACAATGGGCAAGTCAG
CGCCCTCGATAGCCCTCCACTGCTCAGTTCTTCTGGCTCTAGCTCCAGAGAGTCTCGAAGCAAGACACCTGTCAG
AAGCAGTGCACCACGGCCTTACGAAGGTGGTACATATACGTGCACATATCACGGCTGCACCATGAGATTTGAGAC
GCCATGGCTCCTACAGAAACACAAGAGGGAAGGGCACCGGCAACCGCAAGGCCTGGTCCCCAATTCTCGTGATGT
CTCTGCGGCAGTCGTGTTCAATACTCAGGCTGGGCCCCATCGCTGCGACCGTATCAACCCCAGCACAGGGAAGTC
ATGCAATACAGTATTTTCGAGACCGTACGACTTGACTCGCCATGAAGACACGATACACAATGCAAGGAAGCAAAA
AGTGCGCTGCGACTTGTGTTCTGAAGACAAGACTTTTAGCCGCGCCGATGCACTGACCCGGCACTATCGTGTGTG
CCATCCCGACGTGGCACTGCCTGGCAAGCATCGACGTCGCGGCGGACTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail