Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3319
Gene name
LocationContig_249:20809..21287
Strand+
Gene length (bp)478
Transcript length (bp)345
Coding sequence length (bp)345
Protein length (aa) 115

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07876 Dabb Stress responsive A/B Barrel Domain 8.7E-21 3 110

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup492
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3319 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1711
Ophiocordyceps australis map64 (Brazil) OphauB2|4547
Ophiocordyceps camponoti-floridani Ophcf2|03133
Ophiocordyceps kimflemingae Ophio5|3078
Ophiocordyceps subramaniannii Hirsu2|11099
Ophiocordyceps subramaniannii Hirsu2|2303
Ophiocordyceps subramaniannii Hirsu2|6062

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3319
MTVKHIVLFELKPGTDAASKKKLCDAMYGLKDKCAHPTTKKPYVRSMSGGKDMSVEGLQHGHSHAFIVEFDSVAD
RDYYAKEDAAHQAFIVDFFTGPDAILKGATVVDFVPDEF*
Coding >OphauG2|3319
ATGACGGTCAAGCACATTGTCCTCTTTGAGTTGAAGCCCGGCACCGATGCCGCAAGCAAGAAAAAGCTCTGCGAT
GCCATGTATGGCCTCAAGGACAAGTGTGCCCACCCCACCACCAAGAAGCCGTATGTGAGGAGCATGTCGGGCGGC
AAAGACATGTCGGTTGAGGGATTGCAGCACGGCCATAGCCATGCCTTTATTGTCGAGTTTGACAGCGTCGCCGAC
CGCGACTACTACGCCAAGGAGGACGCGGCGCACCAGGCCTTTATTGTCGACTTTTTTACCGGGCCCGACGCCATC
CTCAAGGGCGCCACGGTGGTGGACTTTGTGCCCGACGAGTTTTAA
Transcript >OphauG2|3319
ATGACGGTCAAGCACATTGTCCTCTTTGAGTTGAAGCCCGGCACCGATGCCGCAAGCAAGAAAAAGCTCTGCGAT
GCCATGTATGGCCTCAAGGACAAGTGTGCCCACCCCACCACCAAGAAGCCGTATGTGAGGAGCATGTCGGGCGGC
AAAGACATGTCGGTTGAGGGATTGCAGCACGGCCATAGCCATGCCTTTATTGTCGAGTTTGACAGCGTCGCCGAC
CGCGACTACTACGCCAAGGAGGACGCGGCGCACCAGGCCTTTATTGTCGACTTTTTTACCGGGCCCGACGCCATC
CTCAAGGGCGCCACGGTGGTGGACTTTGTGCCCGACGAGTTTTAA
Gene >OphauG2|3319
ATGACGGTCAAGCACATTGTCCTCTTTGAGTTGAAGCCCGGCACCGATGCCGCAAGCAAGAAAAAGGTACGCATG
GATCAAGCGGCCCCAGCGCATGCCAGTGCTGACGCCACGAGCAGCTCTGCGATGCCATGTATGGCCTCAAGGACA
AGTGTGCCCACCCCACCACCAAGAAGCCGTATGTGAGGAGCATGTCGGGCGGCAAAGACATGTCGGTTGAGGGAT
TGCAGGTATGAGCATCAAAAATCACTTGCTATTCGAGCAGCAGCAAACCGTGCAGAGAGAGCCAAGTCGATGACA
AGCCACGCAGCACGGCCATAGCCATGCCTTTATTGTCGAGTTTGACAGCGTCGCCGACCGCGACTACTACGCCAA
GGAGGACGCGGCGCACCAGGCCTTTATTGTCGACTTTTTTACCGGGCCCGACGCCATCCTCAAGGGCGCCACGGT
GGTGGACTTTGTGCCCGACGAGTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail