Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3304
Gene name
LocationContig_248:1439..5588
Strand-
Gene length (bp)4149
Transcript length (bp)4089
Coding sequence length (bp)4089
Protein length (aa) 1363

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02538 Hydantoinase_B Hydantoinase B/oxoprolinase 1.4E-215 777 1330
PF01968 Hydantoinase_A Hydantoinase/oxoprolinase 5.0E-104 251 556
PF05378 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region 1.1E-60 12 232
PF19278 Hydant_A_C Hydantoinase/oxoprolinase C-terminal domain 2.0E-11 572 759

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28273|OPLA_YEAST 5-oxoprolinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXP1 PE=1 SV=2 7 1329 0.0E+00
sp|Q54NW6|OPLA_DICDI 5-oxoprolinase OS=Dictyostelium discoideum GN=oplah PE=3 SV=2 8 1329 0.0E+00
sp|Q75WB5|OPLA_BOVIN 5-oxoprolinase OS=Bos taurus GN=OPLAH PE=1 SV=1 13 1322 0.0E+00
sp|Q8K010|OPLA_MOUSE 5-oxoprolinase OS=Mus musculus GN=Oplah PE=1 SV=1 13 1329 0.0E+00
sp|P97608|OPLA_RAT 5-oxoprolinase OS=Rattus norvegicus GN=Oplah PE=1 SV=2 13 1329 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28273|OPLA_YEAST 5-oxoprolinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXP1 PE=1 SV=2 7 1329 0.0E+00
sp|Q54NW6|OPLA_DICDI 5-oxoprolinase OS=Dictyostelium discoideum GN=oplah PE=3 SV=2 8 1329 0.0E+00
sp|Q75WB5|OPLA_BOVIN 5-oxoprolinase OS=Bos taurus GN=OPLAH PE=1 SV=1 13 1322 0.0E+00
sp|Q8K010|OPLA_MOUSE 5-oxoprolinase OS=Mus musculus GN=Oplah PE=1 SV=1 13 1329 0.0E+00
sp|P97608|OPLA_RAT 5-oxoprolinase OS=Rattus norvegicus GN=Oplah PE=1 SV=2 13 1329 0.0E+00
sp|O14841|OPLA_HUMAN 5-oxoprolinase OS=Homo sapiens GN=OPLAH PE=1 SV=3 13 1329 0.0E+00
sp|Q9FIZ7|OPLA_ARATH 5-oxoprolinase OS=Arabidopsis thaliana GN=OXP1 PE=2 SV=1 11 1329 0.0E+00
sp|Q10093|YAOE_SCHPO Uncharacterized protein C11D3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.14c PE=3 SV=1 8 1329 0.0E+00
sp|Q10094|YAOF_SCHPO Uncharacterized protein C11D3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.15 PE=3 SV=1 11 1322 0.0E+00
sp|Q58373|Y963_METJA Uncharacterized protein MJ0963 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0963 PE=3 SV=1 776 1323 6.0E-87
sp|Q01262|HYUA_PSESN Hydantoin utilization protein A OS=Pseudomonas sp. (strain NS671) GN=hyuA PE=3 SV=1 15 751 1.0E-58
sp|Q58374|Y964_METJA Uncharacterized protein MJ0964 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0964 PE=3 SV=1 10 749 3.0E-57
sp|Q5P5G4|APCC_AROAE Acetophenone carboxylase gamma subunit OS=Aromatoleum aromaticum (strain EbN1) GN=apc3 PE=1 SV=1 13 762 5.0E-43
sp|Q01263|HYUB_PSESN Hydantoin utilization protein B OS=Pseudomonas sp. (strain NS671) GN=hyuB PE=3 SV=1 774 1347 8.0E-39
sp|Q5P5G2|APCA_AROAE Acetophenone carboxylase alpha subunit OS=Aromatoleum aromaticum (strain EbN1) GN=apc1 PE=1 SV=1 13 744 1.0E-27
sp|Q8RM04|ACXA_XANP2 Acetone carboxylase beta subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acxA PE=1 SV=1 84 760 6.0E-23
sp|Q5P5G5|APCD_AROAE Acetophenone carboxylase delta subunit OS=Aromatoleum aromaticum (strain EbN1) GN=apc4 PE=1 SV=1 813 1282 3.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup429
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3304 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5016
Ophiocordyceps camponoti-floridani Ophcf2|02185
Ophiocordyceps camponoti-rufipedis Ophun1|1483
Ophiocordyceps kimflemingae Ophio5|2867
Ophiocordyceps subramaniannii Hirsu2|4666
Ophiocordyceps subramaniannii Hirsu2|5647
Ophiocordyceps subramaniannii Hirsu2|8834

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3304
MAQTSGKKRGVRIAIDRGGTFTDCVGELHGQHVIIKLLSEDPANYSDAPLEGIRRIMSHFLGRDIPRGEPLDTSE
IESIRMGTTVATNALLERKGERIALIVTAGFRDCLTIGNQSRPRIFDLAIRKPDVLYESVVEIDERVTLEDYAED
PHRTITQPEANVDSPEAQFHSLVRGLSGETVRILKRPQLHEIRQRLQQVYDEGIRSIAVCLMHGYTFPTHEALVG
QVAKEMGFQHISLSHQLMPMVKLVPRATSVCADAYLTPAIKRYIDGFQAGFKGGLGTQSVKEEKGSRGARCEFMQ
SDGGLVDVDKFTGLKAILSGPAGGVVGYAMTSYDAETKVPVIGFDMGGTSTDVSRYGEGRYEHVFETTTAGVTIQ
SPQLDINTVAAGGGSRLFFRNGLFAVGPESAGAHPGPACYRKGGPATVTDANLYLGRLLPDFFPKIFGKNEDEGL
DPDASRQVLEELAEQVNRETGKNLTIDQVAYGFLTVANETMTRPIRSITEAKGHDSSKHRLATFGGAGGQHAVAI
AESLGIGQILVHRYSSVLSAYGMALADVVDEQQEPDSAVWHDDGPVVERLRDKMQKLRKQSRDQLWEQGFEDGDM
EFYEYLNMRYRGTESAIMVVRPPADEVRDLYNGKEWEFAKAFVRQHGYEFGFTLDDRDIIVDDVRVRGVGRSFRH
DEPTVDQQLKTVKRVDVPCEHKDGVRDVYFEGGRLKTPVYRLEALDVGNVVAGPAVLADGTQTIIVTPKTKALIL
ETHVVLNVEQEDSRNECQGDKTRREIDPILLSIFGHRFMAIAEQMGRALQKTSVSTNVKERLDFSCAIFDSTGAL
VANAPHLPVHLGSMSTCVRRQAELWRGRLSRGDVIIANHPSYGGTHLPDVTLVMPAFDASGQHILFYAASRAHHA
DIGGITAGSMPPHSRELFQEGAAVRSEKLVSNGRFDEARVVELFYDEPARYPGCSGTRCLADNINDLRAQVSANQ
KGISLIEGLIAEYGQDTVQLYMEAIQDNAERCVRRLFSHVHRRFQGEDLSAVDYMDDGSPIQLRIKIDAQSGSAE
FDFAGTGPEVYANINAPQAITYSAIIYCIRCLVSDDIPLNQGCLKPIHVKIPPKSLLSPSPGAAVVGGNVLTSQR
VTDVIFKAFQACAASQGCCNNLTFGFGGNQPGREAVRGFGYYETIAGGSGAGPDWHGTSGVHVHMTNTRITDSEI
FERRYPVLLRDFSIRTGSGGAGQHRGGDGVIRDIEFRIPLQVSILSERRVFRPYGLKGGQDGACGLNLWVRNVAK
TETEALGPASKTEGQSQCAPEYEERRINLGAKNSAAMEAGDRIIIHTPGGGGWGPSQQASVAKLRPDHTESWRKG
SGAAREEAALQA*
Coding >OphauG2|3304
ATGGCTCAGACATCTGGGAAGAAGCGCGGTGTTCGCATCGCCATTGACCGCGGTGGCACCTTTACCGACTGTGTG
GGTGAACTTCATGGCCAGCACGTCATAATCAAGCTCCTCTCCGAGGATCCCGCCAACTATAGTGATGCACCACTA
GAAGGCATTCGACGCATCATGAGCCACTTCCTCGGACGTGATATACCCCGTGGAGAGCCTCTAGACACTTCAGAA
ATCGAATCAATACGCATGGGAACTACTGTGGCCACCAATGCTCTACTCGAGCGCAAGGGCGAACGCATCGCACTT
ATCGTGACTGCCGGGTTTCGTGACTGCTTGACAATCGGCAACCAGTCTCGTCCGCGCATATTTGACCTGGCCATA
CGCAAGCCTGACGTCCTCTACGAGTCTGTTGTTGAAATTGATGAACGCGTTACCCTCGAGGACTATGCCGAAGAT
CCTCATCGCACCATTACTCAACCAGAGGCCAATGTTGACTCCCCAGAGGCCCAATTTCATAGTCTTGTTCGAGGT
CTGTCGGGCGAGACGGTGCGTATTCTCAAGAGACCGCAGCTACATGAAATTCGTCAACGGTTACAACAAGTATAT
GACGAGGGAATCCGAAGCATCGCCGTCTGTCTCATGCACGGCTACACCTTTCCCACTCACGAGGCCCTCGTCGGT
CAAGTGGCCAAGGAAATGGGCTTCCAGCACATCTCCCTCAGTCATCAGCTCATGCCCATGGTCAAGCTGGTCCCC
CGCGCCACATCAGTCTGTGCTGACGCATACTTGACGCCCGCAATCAAGAGATATATCGATGGCTTTCAAGCCGGC
TTCAAGGGCGGTTTGGGGACTCAAAGCGTCAAGGAGGAAAAGGGGTCCCGCGGCGCCCGTTGTGAGTTTATGCAG
AGCGACGGTGGACTGGTCGATGTGGACAAGTTTACAGGCCTCAAGGCCATCCTGTCAGGCCCGGCGGGGGGAGTT
GTGGGCTACGCCATGACGTCGTACGATGCAGAGACAAAGGTGCCCGTCATTGGTTTTGACATGGGCGGCACCAGC
ACCGATGTATCGCGCTATGGCGAGGGCCGATATGAACACGTCTTTGAGACGACGACTGCCGGCGTCACCATCCAG
TCGCCTCAGCTCGATATCAACACGGTTGCCGCAGGCGGGGGCTCGCGCCTCTTCTTCCGAAACGGGCTTTTTGCC
GTTGGCCCTGAGTCTGCTGGCGCCCATCCAGGACCTGCGTGCTATCGCAAGGGGGGGCCAGCCACGGTGACGGAT
GCCAATCTGTACCTGGGGCGTCTCTTGCCAGACTTTTTCCCCAAAATCTTTGGCAAAAACGAAGATGAGGGACTG
GATCCCGACGCAAGCAGACAAGTGCTCGAGGAGCTGGCCGAGCAGGTCAACCGCGAGACGGGCAAAAATCTCACC
ATTGATCAAGTGGCGTATGGATTTCTCACCGTGGCCAACGAAACCATGACGCGGCCCATACGGTCCATCACCGAG
GCCAAAGGCCATGACTCGTCCAAGCACCGGCTTGCCACGTTTGGAGGGGCGGGCGGCCAGCATGCCGTAGCCATT
GCCGAGTCGCTCGGCATCGGGCAGATTTTGGTGCACCGCTATTCCTCGGTTCTGTCGGCCTATGGCATGGCTCTT
GCCGACGTGGTGGACGAGCAACAGGAGCCCGACTCGGCCGTATGGCACGACGACGGCCCCGTAGTCGAGCGACTG
CGCGACAAGATGCAAAAACTGAGGAAGCAGTCGCGTGACCAACTCTGGGAACAGGGGTTCGAAGACGGCGACATG
GAGTTTTACGAGTACCTCAACATGCGCTACCGCGGCACAGAGTCGGCAATAATGGTGGTCAGGCCGCCGGCCGAC
GAGGTGCGCGACTTGTATAATGGCAAGGAATGGGAATTTGCAAAGGCCTTTGTTCGCCAACATGGCTATGAGTTT
GGCTTCACCCTTGACGACAGAGACATTATTGTCGACGACGTGCGCGTGCGAGGCGTTGGGCGCAGTTTTCGACAT
GACGAGCCGACTGTTGACCAGCAGCTCAAGACTGTCAAGCGCGTCGACGTGCCATGCGAGCACAAGGACGGCGTC
AGAGACGTCTACTTTGAGGGCGGGCGACTCAAGACACCAGTCTATAGGCTCGAGGCTCTTGATGTGGGAAACGTG
GTGGCTGGCCCGGCGGTGCTGGCAGACGGCACGCAGACCATCATCGTGACGCCAAAGACCAAGGCTCTTATTCTC
GAGACGCACGTCGTGCTCAATGTGGAGCAAGAGGATTCGAGGAACGAATGTCAAGGCGACAAGACGAGGCGTGAA
ATAGACCCCATTCTGCTCAGCATCTTTGGCCATCGCTTCATGGCCATTGCCGAGCAGATGGGCCGGGCGCTGCAA
AAGACGAGCGTCAGCACAAACGTCAAGGAGCGTCTCGACTTTTCCTGCGCCATCTTTGACTCGACGGGCGCCCTG
GTGGCCAACGCGCCGCATCTGCCCGTCCACCTTGGCTCCATGTCGACGTGTGTGCGGCGCCAGGCCGAACTGTGG
CGCGGCCGCCTCAGTCGCGGCGATGTCATTATCGCCAACCATCCGTCGTACGGCGGCACTCACCTGCCCGACGTG
ACGCTCGTCATGCCCGCCTTTGACGCCTCGGGCCAGCACATTCTCTTCTACGCCGCGTCGCGCGCCCACCACGCC
GACATTGGCGGCATCACGGCCGGCAGCATGCCGCCGCATTCGCGCGAGCTGTTCCAGGAGGGCGCGGCGGTGCGA
AGCGAGAAGCTCGTGTCCAACGGGCGCTTTGACGAGGCTCGAGTTGTCGAGCTCTTCTACGACGAGCCGGCTCGC
TATCCCGGCTGCAGCGGCACGCGCTGTCTGGCCGACAACATCAACGACTTGCGCGCCCAAGTCTCGGCCAACCAA
AAGGGCATTTCGCTCATCGAGGGCCTCATTGCCGAGTATGGCCAGGACACGGTCCAGCTGTACATGGAGGCCATC
CAGGACAACGCGGAGCGGTGCGTGAGGCGGCTGTTTAGCCACGTCCACCGCCGCTTCCAGGGCGAGGACCTGTCG
GCTGTCGACTACATGGACGACGGCTCGCCCATCCAGCTGCGCATCAAGATCGACGCCCAGTCGGGCAGCGCCGAA
TTCGACTTTGCCGGCACCGGCCCCGAGGTGTACGCCAACATCAACGCGCCCCAGGCCATCACCTACAGCGCCATC
ATCTACTGCATCCGCTGCCTCGTGTCCGACGACATTCCCCTCAACCAGGGCTGTCTCAAGCCCATCCACGTCAAG
ATCCCGCCCAAGTCGCTGCTGTCGCCGTCGCCCGGCGCCGCCGTTGTGGGCGGCAACGTGCTCACCAGCCAGCGC
GTCACCGACGTCATCTTCAAGGCTTTCCAGGCCTGTGCCGCCTCGCAGGGCTGCTGCAACAACCTCACCTTTGGC
TTTGGCGGCAACCAGCCGGGCAGGGAGGCCGTCCGCGGCTTTGGCTACTACGAGACCATTGCTGGCGGCAGCGGC
GCCGGCCCCGACTGGCACGGCACCTCGGGCGTGCACGTGCACATGACCAACACTCGCATCACCGACTCGGAGATT
TTCGAGCGCCGCTATCCCGTGCTGCTGCGAGACTTTTCCATCCGCACCGGCTCGGGGGGTGCCGGCCAGCATCGC
GGAGGCGACGGCGTCATCCGCGACATTGAGTTCCGCATCCCGCTGCAAGTGTCCATCCTGAGTGAGCGCCGCGTC
TTCCGGCCCTATGGGCTCAAGGGCGGCCAGGACGGCGCCTGTGGGCTCAACCTGTGGGTGCGCAACGTGGCAAAG
ACAGAGACGGAAGCGCTGGGTCCGGCATCCAAGACTGAGGGCCAGAGTCAGTGCGCCCCAGAGTACGAAGAGCGC
CGCATCAACCTGGGAGCCAAGAACAGCGCCGCCATGGAGGCAGGCGACCGCATCATCATCCACACGCCCGGTGGC
GGTGGCTGGGGCCCAAGCCAACAGGCCAGTGTGGCCAAGCTGAGGCCTGACCATACCGAGAGCTGGCGCAAGGGA
AGCGGGGCGGCGAGGGAAGAGGCCGCACTACAGGCCTGA
Transcript >OphauG2|3304
ATGGCTCAGACATCTGGGAAGAAGCGCGGTGTTCGCATCGCCATTGACCGCGGTGGCACCTTTACCGACTGTGTG
GGTGAACTTCATGGCCAGCACGTCATAATCAAGCTCCTCTCCGAGGATCCCGCCAACTATAGTGATGCACCACTA
GAAGGCATTCGACGCATCATGAGCCACTTCCTCGGACGTGATATACCCCGTGGAGAGCCTCTAGACACTTCAGAA
ATCGAATCAATACGCATGGGAACTACTGTGGCCACCAATGCTCTACTCGAGCGCAAGGGCGAACGCATCGCACTT
ATCGTGACTGCCGGGTTTCGTGACTGCTTGACAATCGGCAACCAGTCTCGTCCGCGCATATTTGACCTGGCCATA
CGCAAGCCTGACGTCCTCTACGAGTCTGTTGTTGAAATTGATGAACGCGTTACCCTCGAGGACTATGCCGAAGAT
CCTCATCGCACCATTACTCAACCAGAGGCCAATGTTGACTCCCCAGAGGCCCAATTTCATAGTCTTGTTCGAGGT
CTGTCGGGCGAGACGGTGCGTATTCTCAAGAGACCGCAGCTACATGAAATTCGTCAACGGTTACAACAAGTATAT
GACGAGGGAATCCGAAGCATCGCCGTCTGTCTCATGCACGGCTACACCTTTCCCACTCACGAGGCCCTCGTCGGT
CAAGTGGCCAAGGAAATGGGCTTCCAGCACATCTCCCTCAGTCATCAGCTCATGCCCATGGTCAAGCTGGTCCCC
CGCGCCACATCAGTCTGTGCTGACGCATACTTGACGCCCGCAATCAAGAGATATATCGATGGCTTTCAAGCCGGC
TTCAAGGGCGGTTTGGGGACTCAAAGCGTCAAGGAGGAAAAGGGGTCCCGCGGCGCCCGTTGTGAGTTTATGCAG
AGCGACGGTGGACTGGTCGATGTGGACAAGTTTACAGGCCTCAAGGCCATCCTGTCAGGCCCGGCGGGGGGAGTT
GTGGGCTACGCCATGACGTCGTACGATGCAGAGACAAAGGTGCCCGTCATTGGTTTTGACATGGGCGGCACCAGC
ACCGATGTATCGCGCTATGGCGAGGGCCGATATGAACACGTCTTTGAGACGACGACTGCCGGCGTCACCATCCAG
TCGCCTCAGCTCGATATCAACACGGTTGCCGCAGGCGGGGGCTCGCGCCTCTTCTTCCGAAACGGGCTTTTTGCC
GTTGGCCCTGAGTCTGCTGGCGCCCATCCAGGACCTGCGTGCTATCGCAAGGGGGGGCCAGCCACGGTGACGGAT
GCCAATCTGTACCTGGGGCGTCTCTTGCCAGACTTTTTCCCCAAAATCTTTGGCAAAAACGAAGATGAGGGACTG
GATCCCGACGCAAGCAGACAAGTGCTCGAGGAGCTGGCCGAGCAGGTCAACCGCGAGACGGGCAAAAATCTCACC
ATTGATCAAGTGGCGTATGGATTTCTCACCGTGGCCAACGAAACCATGACGCGGCCCATACGGTCCATCACCGAG
GCCAAAGGCCATGACTCGTCCAAGCACCGGCTTGCCACGTTTGGAGGGGCGGGCGGCCAGCATGCCGTAGCCATT
GCCGAGTCGCTCGGCATCGGGCAGATTTTGGTGCACCGCTATTCCTCGGTTCTGTCGGCCTATGGCATGGCTCTT
GCCGACGTGGTGGACGAGCAACAGGAGCCCGACTCGGCCGTATGGCACGACGACGGCCCCGTAGTCGAGCGACTG
CGCGACAAGATGCAAAAACTGAGGAAGCAGTCGCGTGACCAACTCTGGGAACAGGGGTTCGAAGACGGCGACATG
GAGTTTTACGAGTACCTCAACATGCGCTACCGCGGCACAGAGTCGGCAATAATGGTGGTCAGGCCGCCGGCCGAC
GAGGTGCGCGACTTGTATAATGGCAAGGAATGGGAATTTGCAAAGGCCTTTGTTCGCCAACATGGCTATGAGTTT
GGCTTCACCCTTGACGACAGAGACATTATTGTCGACGACGTGCGCGTGCGAGGCGTTGGGCGCAGTTTTCGACAT
GACGAGCCGACTGTTGACCAGCAGCTCAAGACTGTCAAGCGCGTCGACGTGCCATGCGAGCACAAGGACGGCGTC
AGAGACGTCTACTTTGAGGGCGGGCGACTCAAGACACCAGTCTATAGGCTCGAGGCTCTTGATGTGGGAAACGTG
GTGGCTGGCCCGGCGGTGCTGGCAGACGGCACGCAGACCATCATCGTGACGCCAAAGACCAAGGCTCTTATTCTC
GAGACGCACGTCGTGCTCAATGTGGAGCAAGAGGATTCGAGGAACGAATGTCAAGGCGACAAGACGAGGCGTGAA
ATAGACCCCATTCTGCTCAGCATCTTTGGCCATCGCTTCATGGCCATTGCCGAGCAGATGGGCCGGGCGCTGCAA
AAGACGAGCGTCAGCACAAACGTCAAGGAGCGTCTCGACTTTTCCTGCGCCATCTTTGACTCGACGGGCGCCCTG
GTGGCCAACGCGCCGCATCTGCCCGTCCACCTTGGCTCCATGTCGACGTGTGTGCGGCGCCAGGCCGAACTGTGG
CGCGGCCGCCTCAGTCGCGGCGATGTCATTATCGCCAACCATCCGTCGTACGGCGGCACTCACCTGCCCGACGTG
ACGCTCGTCATGCCCGCCTTTGACGCCTCGGGCCAGCACATTCTCTTCTACGCCGCGTCGCGCGCCCACCACGCC
GACATTGGCGGCATCACGGCCGGCAGCATGCCGCCGCATTCGCGCGAGCTGTTCCAGGAGGGCGCGGCGGTGCGA
AGCGAGAAGCTCGTGTCCAACGGGCGCTTTGACGAGGCTCGAGTTGTCGAGCTCTTCTACGACGAGCCGGCTCGC
TATCCCGGCTGCAGCGGCACGCGCTGTCTGGCCGACAACATCAACGACTTGCGCGCCCAAGTCTCGGCCAACCAA
AAGGGCATTTCGCTCATCGAGGGCCTCATTGCCGAGTATGGCCAGGACACGGTCCAGCTGTACATGGAGGCCATC
CAGGACAACGCGGAGCGGTGCGTGAGGCGGCTGTTTAGCCACGTCCACCGCCGCTTCCAGGGCGAGGACCTGTCG
GCTGTCGACTACATGGACGACGGCTCGCCCATCCAGCTGCGCATCAAGATCGACGCCCAGTCGGGCAGCGCCGAA
TTCGACTTTGCCGGCACCGGCCCCGAGGTGTACGCCAACATCAACGCGCCCCAGGCCATCACCTACAGCGCCATC
ATCTACTGCATCCGCTGCCTCGTGTCCGACGACATTCCCCTCAACCAGGGCTGTCTCAAGCCCATCCACGTCAAG
ATCCCGCCCAAGTCGCTGCTGTCGCCGTCGCCCGGCGCCGCCGTTGTGGGCGGCAACGTGCTCACCAGCCAGCGC
GTCACCGACGTCATCTTCAAGGCTTTCCAGGCCTGTGCCGCCTCGCAGGGCTGCTGCAACAACCTCACCTTTGGC
TTTGGCGGCAACCAGCCGGGCAGGGAGGCCGTCCGCGGCTTTGGCTACTACGAGACCATTGCTGGCGGCAGCGGC
GCCGGCCCCGACTGGCACGGCACCTCGGGCGTGCACGTGCACATGACCAACACTCGCATCACCGACTCGGAGATT
TTCGAGCGCCGCTATCCCGTGCTGCTGCGAGACTTTTCCATCCGCACCGGCTCGGGGGGTGCCGGCCAGCATCGC
GGAGGCGACGGCGTCATCCGCGACATTGAGTTCCGCATCCCGCTGCAAGTGTCCATCCTGAGTGAGCGCCGCGTC
TTCCGGCCCTATGGGCTCAAGGGCGGCCAGGACGGCGCCTGTGGGCTCAACCTGTGGGTGCGCAACGTGGCAAAG
ACAGAGACGGAAGCGCTGGGTCCGGCATCCAAGACTGAGGGCCAGAGTCAGTGCGCCCCAGAGTACGAAGAGCGC
CGCATCAACCTGGGAGCCAAGAACAGCGCCGCCATGGAGGCAGGCGACCGCATCATCATCCACACGCCCGGTGGC
GGTGGCTGGGGCCCAAGCCAACAGGCCAGTGTGGCCAAGCTGAGGCCTGACCATACCGAGAGCTGGCGCAAGGGA
AGCGGGGCGGCGAGGGAAGAGGCCGCACTACAGGCCTGA
Gene >OphauG2|3304
ATGGCTCAGACATCTGGGAAGAAGCGCGGTGTTCGCATCGCCATTGACCGCGGTGGCACCTTTACCGACTGTGTG
GGTGAACTTCATGGCCAGCACGTCATAATCAAGCTCCTCTCCGAGGATCCCGCCAACTATAGTGATGCACCACTA
GAAGGCATTCGACGCATCATGAGCCACTTCCTCGGACGTGATATACCCCGTGGAGAGCCTCTAGACACTTCAGAA
ATCGAATCAATACGCATGGGAACTACTGTGGCCACCAATGCTCTACTCGAGCGCAAGGGCGAACGCATCGCACTT
ATCGTGACTGCCGGGTTTCGTGACTGCTTGACAATCGGCAACCAGTCTCGTCCGCGCATATTTGACCTGGCCATA
CGCAAGCCTGACGTCCTCTACGAGTCTGTTGTTGAAATTGATGAACGCGTTACCCTCGAGGACTATGCCGAAGAT
CCTCATCGCACCATTACTCAACCAGAGGCCAATGTTGACTCCCCAGAGGCCCAATTTCATAGTCTTGTTCGAGGT
CTGTCGGGCGAGACGGTGCGTATTCTCAAGAGACCGCAGCTACATGAAATTCGTCAACGGTTACAACAAGTATAT
GACGAGGGAATCCGAAGCATCGCCGTCTGTCTCATGCACGGCTACACCTTTCCCACTCACGAGGCCCTCGTCGGT
CAAGTGGCCAAGGAAATGGGCTTCCAGCACATCTCCCTCAGTCATCAGCTCATGCCCATGGTCAAGCTGGTCCCC
CGCGCCACATCAGTCTGTGCTGACGCATACTTGACGCCCGCAATCAAGAGATATATCGATGGCTTTCAAGCCGGC
TTCAAGGGCGGTTTGGGGACTCAAAGCGTCAAGGAGGAAAAGGGGTCCCGCGGCGCCCGTTGTGAGTTTATGCAG
AGCGACGGTGGACTGGTCGATGTGGACAAGTTTACAGGCCTCAAGGCCATCCTGTCAGGCCCGGCGGGGGGAGTT
GTGGGCTACGCCATGACGTCGTACGATGCAGAGACAAAGGTGCCCGTCATTGGTTTTGACATGGGCGGCACCAGC
ACCGATGTATCGCGCTATGGCGAGGGCCGATATGAACACGTCTTTGAGACGACGACTGCCGGCGTCACCATCCAG
TCGCCTCAGCTCGATATCAACACGGTTGCCGCAGGCGGGGGCTCGCGCCTCTTCTTCCGAAACGGGCTTTTTGCC
GTTGGCCCTGAGTCTGCTGGCGCCCATCCAGGACCTGCGTGCTATCGCAAGGGGGGGCCAGCCACGGTGACGGAT
GCCAATCTGTACCTGGGGCGTCTCTTGCCAGACTTTTTCCCCAAAATCTTTGGCAAAAACGAAGATGAGGGACTG
GATCCCGACGCAAGCAGACAAGTGCTCGAGGAGCTGGCCGAGCAGGTCAACCGCGAGACGGGCAAAAATCTCACC
ATTGATCAAGTGGCGTATGGATTTCTCACCGTGGCCAACGAAACCATGACGCGGCCCATACGGTCCATCACCGAG
GCCAAAGGCCATGACTCGTCCAAGCACCGGCTTGCCACGTTTGGAGGGGCGGGCGGCCAGCATGCCGTAGCCATT
GCCGAGTCGCTCGGCATCGGGCAGATTTTGGTGCACCGCTATTCCTCGGTTCTGTCGGCCTATGGCATGGCTCTT
GCCGACGTGGTGGACGAGCAACAGGAGCCCGACTCGGCCGTATGGCACGACGACGGCCCCGTAGTCGAGCGACTG
CGCGACAAGATGCAAAAACTGAGGAAGCAGTCGCGTGACCAACTCTGGGAACAGGGGTTCGAAGACGGCGACATG
GAGTTTTACGAGTACCTCAACATGCGCTACCGCGGCACAGAGTCGGCAATAATGGTGGTCAGGCCGCCGGCCGAC
GAGGTGCGCGACTTGTATAATGGCAAGGAATGGGAATTTGCAAAGGCCTTTGTTCGCCAACATGGCTATGAGTTT
GGCTTCACCCTTGACGACAGAGACATTATTGTCGACGACGTGCGCGTGCGAGGCGTTGGGCGCAGTTTTCGACAT
GACGAGCCGACTGTTGACCAGCAGCTCAAGACTGTCAAGCGCGTCGACGTGCCATGCGAGCACAAGGACGGCGTC
AGAGACGTCTACTTTGAGGGCGGGCGACTCAAGACACCAGTCTATAGGCTCGAGGCTCTTGATGTGGGAAACGTG
GTGGCTGGCCCGGCGGTGCTGGCAGACGGCACGCAGACCATCATCGTGACGCCAAAGACCAAGGCTCTTATTCTC
GAGACGCACGTCGTGCTCAATGTGGAGCAAGAGGATTCGAGGAACGAGTTGGTGTTGCATCTTTGCCCCTTTTGC
ATAGACAAGAGCGTCTTGCTAACACCAGGCAGATGTCAAGGCGACAAGACGAGGCGTGAAATAGACCCCATTCTG
CTCAGCATCTTTGGCCATCGCTTCATGGCCATTGCCGAGCAGATGGGCCGGGCGCTGCAAAAGACGAGCGTCAGC
ACAAACGTCAAGGAGCGTCTCGACTTTTCCTGCGCCATCTTTGACTCGACGGGCGCCCTGGTGGCCAACGCGCCG
CATCTGCCCGTCCACCTTGGCTCCATGTCGACGTGTGTGCGGCGCCAGGCCGAACTGTGGCGCGGCCGCCTCAGT
CGCGGCGATGTCATTATCGCCAACCATCCGTCGTACGGCGGCACTCACCTGCCCGACGTGACGCTCGTCATGCCC
GCCTTTGACGCCTCGGGCCAGCACATTCTCTTCTACGCCGCGTCGCGCGCCCACCACGCCGACATTGGCGGCATC
ACGGCCGGCAGCATGCCGCCGCATTCGCGCGAGCTGTTCCAGGAGGGCGCGGCGGTGCGAAGCGAGAAGCTCGTG
TCCAACGGGCGCTTTGACGAGGCTCGAGTTGTCGAGCTCTTCTACGACGAGCCGGCTCGCTATCCCGGCTGCAGC
GGCACGCGCTGTCTGGCCGACAACATCAACGACTTGCGCGCCCAAGTCTCGGCCAACCAAAAGGGCATTTCGCTC
ATCGAGGGCCTCATTGCCGAGTATGGCCAGGACACGGTCCAGCTGTACATGGAGGCCATCCAGGACAACGCGGAG
CGGTGCGTGAGGCGGCTGTTTAGCCACGTCCACCGCCGCTTCCAGGGCGAGGACCTGTCGGCTGTCGACTACATG
GACGACGGCTCGCCCATCCAGCTGCGCATCAAGATCGACGCCCAGTCGGGCAGCGCCGAATTCGACTTTGCCGGC
ACCGGCCCCGAGGTGTACGCCAACATCAACGCGCCCCAGGCCATCACCTACAGCGCCATCATCTACTGCATCCGC
TGCCTCGTGTCCGACGACATTCCCCTCAACCAGGGCTGTCTCAAGCCCATCCACGTCAAGATCCCGCCCAAGTCG
CTGCTGTCGCCGTCGCCCGGCGCCGCCGTTGTGGGCGGCAACGTGCTCACCAGCCAGCGCGTCACCGACGTCATC
TTCAAGGCTTTCCAGGCCTGTGCCGCCTCGCAGGGCTGCTGCAACAACCTCACCTTTGGCTTTGGCGGCAACCAG
CCGGGCAGGGAGGCCGTCCGCGGCTTTGGCTACTACGAGACCATTGCTGGCGGCAGCGGCGCCGGCCCCGACTGG
CACGGCACCTCGGGCGTGCACGTGCACATGACCAACACTCGCATCACCGACTCGGAGATTTTCGAGCGCCGCTAT
CCCGTGCTGCTGCGAGACTTTTCCATCCGCACCGGCTCGGGGGGTGCCGGCCAGCATCGCGGAGGCGACGGCGTC
ATCCGCGACATTGAGTTCCGCATCCCGCTGCAAGTGTCCATCCTGAGTGAGCGCCGCGTCTTCCGGCCCTATGGG
CTCAAGGGCGGCCAGGACGGCGCCTGTGGGCTCAACCTGTGGGTGCGCAACGTGGCAAAGACAGAGACGGAAGCG
CTGGGTCCGGCATCCAAGACTGAGGGCCAGAGTCAGTGCGCCCCAGAGTACGAAGAGCGCCGCATCAACCTGGGA
GCCAAGAACAGCGCCGCCATGGAGGCAGGCGACCGCATCATCATCCACACGCCCGGTGGCGGTGGCTGGGGCCCA
AGCCAACAGGCCAGTGTGGCCAAGCTGAGGCCTGACCATACCGAGAGCTGGCGCAAGGGAAGCGGGGCGGCGAGG
GAAGAGGCCGCACTACAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail