Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3290
Gene name
LocationContig_246:13359..14220
Strand+
Gene length (bp)861
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11968 Bmt2 25S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2 4.8E-77 61 282

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38278|BMT2_YEAST 25S rRNA (adenine(2142)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMT2 PE=1 SV=2 64 284 2.0E-37
sp|Q9UUH2|BMT2_SCHPO 25S rRNA adenine-N(1) methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.10 PE=3 SV=1 34 282 3.0E-35

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5492
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3290 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2788
Ophiocordyceps camponoti-floridani Ophcf2|06044
Ophiocordyceps camponoti-rufipedis Ophun1|3143
Ophiocordyceps kimflemingae Ophio5|2516
Ophiocordyceps subramaniannii Hirsu2|6586

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3290
MRVGKKKSLKSLQAGRPPTASPAGSMTRKASRTLINRIHQLEKRKLQAAEKGDQDSEVAAAADIAALGGLHLYQQ
ASLQGQSPGRGGDTSKVLLEWLPVCDMKTSNWCPRMLEVGALTCHNACTTSGLFDMVHIDLNSQDPAIKKQDFMK
RPLPERHVDKFDIISLSLVLNFVPSAAARGLMLARTLSFLRTAAPDLPGAATMPFPSLFLVLPRSCVGNSRYLTQ
EKLALIMDVLGYDMIKSKMSQKLAYSLWKKNLKAGPTKVRLAKVEVNPGRNRNNFAISLDL*
Coding >OphauG2|3290
ATGCGCGTCGGAAAGAAAAAGTCGCTCAAAAGCCTCCAAGCCGGTAGGCCCCCAACGGCTAGTCCAGCAGGCTCT
ATGACGCGCAAAGCCAGTCGCACCCTTATCAACCGAATTCATCAACTAGAGAAAAGGAAACTTCAGGCAGCGGAA
AAAGGTGACCAGGATTCTGAAGTGGCTGCGGCTGCTGACATTGCTGCCCTTGGTGGACTGCATCTCTACCAACAA
GCCAGTCTACAGGGACAGAGCCCCGGACGGGGAGGTGACACATCAAAAGTGCTGCTCGAATGGTTGCCAGTGTGT
GACATGAAGACTTCAAATTGGTGTCCAAGGATGCTCGAGGTCGGCGCACTTACTTGTCACAATGCCTGTACTACT
AGTGGCCTCTTTGACATGGTACACATTGATCTAAACAGCCAGGACCCAGCCATCAAAAAGCAGGACTTTATGAAG
CGACCACTTCCTGAGCGCCATGTAGACAAATTCGACATCATCTCCCTCAGTCTGGTACTGAACTTTGTACCAAGT
GCTGCGGCCCGTGGTCTAATGTTGGCTCGAACGCTCTCTTTCCTACGGACTGCTGCCCCGGATCTGCCAGGTGCA
GCCACGATGCCATTTCCATCACTCTTTTTGGTTTTACCAAGAAGTTGTGTCGGTAACTCGCGCTACCTGACGCAG
GAAAAGTTGGCTCTCATAATGGATGTTCTCGGTTACGACATGATCAAGTCCAAAATGTCACAGAAGCTCGCCTAC
AGCCTGTGGAAGAAAAACTTAAAAGCGGGCCCCACCAAAGTTCGGCTTGCAAAAGTCGAGGTTAACCCCGGACGA
AATCGAAACAATTTTGCCATCAGCCTCGACTTATAA
Transcript >OphauG2|3290
ATGCGCGTCGGAAAGAAAAAGTCGCTCAAAAGCCTCCAAGCCGGTAGGCCCCCAACGGCTAGTCCAGCAGGCTCT
ATGACGCGCAAAGCCAGTCGCACCCTTATCAACCGAATTCATCAACTAGAGAAAAGGAAACTTCAGGCAGCGGAA
AAAGGTGACCAGGATTCTGAAGTGGCTGCGGCTGCTGACATTGCTGCCCTTGGTGGACTGCATCTCTACCAACAA
GCCAGTCTACAGGGACAGAGCCCCGGACGGGGAGGTGACACATCAAAAGTGCTGCTCGAATGGTTGCCAGTGTGT
GACATGAAGACTTCAAATTGGTGTCCAAGGATGCTCGAGGTCGGCGCACTTACTTGTCACAATGCCTGTACTACT
AGTGGCCTCTTTGACATGGTACACATTGATCTAAACAGCCAGGACCCAGCCATCAAAAAGCAGGACTTTATGAAG
CGACCACTTCCTGAGCGCCATGTAGACAAATTCGACATCATCTCCCTCAGTCTGGTACTGAACTTTGTACCAAGT
GCTGCGGCCCGTGGTCTAATGTTGGCTCGAACGCTCTCTTTCCTACGGACTGCTGCCCCGGATCTGCCAGGTGCA
GCCACGATGCCATTTCCATCACTCTTTTTGGTTTTACCAAGAAGTTGTGTCGGTAACTCGCGCTACCTGACGCAG
GAAAAGTTGGCTCTCATAATGGATGTTCTCGGTTACGACATGATCAAGTCCAAAATGTCACAGAAGCTCGCCTAC
AGCCTGTGGAAGAAAAACTTAAAAGCGGGCCCCACCAAAGTTCGGCTTGCAAAAGTCGAGGTTAACCCCGGACGA
AATCGAAACAATTTTGCCATCAGCCTCGACTTATAA
Gene >OphauG2|3290
ATGCGCGTCGGAAAGAAAAAGTCGCTCAAAAGCCTCCAAGCCGGTAGGCCCCCAACGGCTAGTCCAGCAGGCTCT
ATGACGCGCAAAGCCAGTCGCACCCTTATCAACCGAATTCATCAACTAGAGAAAAGGAAACTTCAGGCAGCGGAA
AAAGGTGACCAGGATTCTGAAGTGGCTGCGGCTGCTGACATTGCTGCCCTTGGTGGACTGCATCTCTACCAACAA
GCCAGTCTACAGGGACAGAGCCCCGGACGGGGAGGTGACACATCAAAAGTGCTGCTCGAATGGTTGCCAGTGTGT
GACATGAAGACTTCAAATTGGTGTCCAAGGATGCTCGAGGTCGGCGCACTTACTTGTCACAATGCCTGTACTACT
AGTGGCCTCTTTGACATGGTACACATTGATCTAAACAGCCAGGACCCAGCCATCAAAAAGCAGGACTTTATGAAG
CGACCACTTCCTGAGCGCCATGTAGACAAATTCGACATCATCTCCCTCAGTCTGGTACTGAACTTTGTACCAAGT
GCTGCGGCCCGTGGTCTAATGTTGGCTCGAACGCTCTCTTTCCTACGGACTGCTGCCCCGGATCTGCCAGGTGCA
GCCACGATGCCATTTCCATCACTCTTTTTGGTTTTACCAAGAAGTTGTGTCGGTAACTCGCGCTACCTGACGCAG
GAAAAGTTGGCTCTCATAATGGATGTTCTCGGTTACGACATGATCAAGTCCAAAATGTCACAGAAGCTCGCCTAC
AGCCTGTGGAAGAAAAACTTAAAAGCGGGCCCCACCAAAGTTCGGCTTGCAAAAGTCGAGGTTAACCCCGGACGA
AATCGAAACAATTTTGCCATCAGCCTCGACTTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail