© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|3287 |
| Gene name | |
| Location | Contig_246:6810..7247 |
| Strand | - |
| Gene length (bp) | 437 |
| Transcript length (bp) | 273 |
| Coding sequence length (bp) | 273 |
| Protein length (aa) | 91 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF06645 | SPC12 | Microsomal signal peptidase 12 kDa subunit (SPC12) | 3.6E-28 | 17 | 86 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O44953|SPCS1_CAEEL | Probable signal peptidase complex subunit 1 OS=Caenorhabditis elegans GN=C34B2.10 PE=3 SV=1 | 17 | 82 | 9.0E-14 |
| sp|Q61CQ8|SPCS1_CAEBR | Probable signal peptidase complex subunit 1 OS=Caenorhabditis briggsae GN=CBG12804 PE=3 SV=1 | 17 | 82 | 9.0E-13 |
| sp|Q5RF96|SPCS1_PONAB | Signal peptidase complex subunit 1 OS=Pongo abelii GN=SPCS1 PE=3 SV=1 | 17 | 84 | 5.0E-10 |
| sp|Q9Y6A9|SPCS1_HUMAN | Signal peptidase complex subunit 1 OS=Homo sapiens GN=SPCS1 PE=1 SV=4 | 17 | 84 | 5.0E-10 |
| sp|B0FWK4|SPCS1_PIG | Signal peptidase complex subunit 1 OS=Sus scrofa GN=SPCS1 PE=3 SV=1 | 17 | 84 | 5.0E-10 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O44953|SPCS1_CAEEL | Probable signal peptidase complex subunit 1 OS=Caenorhabditis elegans GN=C34B2.10 PE=3 SV=1 | 17 | 82 | 9.0E-14 |
| sp|Q61CQ8|SPCS1_CAEBR | Probable signal peptidase complex subunit 1 OS=Caenorhabditis briggsae GN=CBG12804 PE=3 SV=1 | 17 | 82 | 9.0E-13 |
| sp|Q5RF96|SPCS1_PONAB | Signal peptidase complex subunit 1 OS=Pongo abelii GN=SPCS1 PE=3 SV=1 | 17 | 84 | 5.0E-10 |
| sp|Q9Y6A9|SPCS1_HUMAN | Signal peptidase complex subunit 1 OS=Homo sapiens GN=SPCS1 PE=1 SV=4 | 17 | 84 | 5.0E-10 |
| sp|B0FWK4|SPCS1_PIG | Signal peptidase complex subunit 1 OS=Sus scrofa GN=SPCS1 PE=3 SV=1 | 17 | 84 | 5.0E-10 |
| sp|Q3T134|SPCS1_BOVIN | Signal peptidase complex subunit 1 OS=Bos taurus GN=SPCS1 PE=3 SV=1 | 17 | 84 | 6.0E-10 |
| sp|Q9D958|SPCS1_MOUSE | Signal peptidase complex subunit 1 OS=Mus musculus GN=Spcs1 PE=2 SV=3 | 17 | 84 | 1.0E-09 |
| sp|Q944J0|SPCS1_ARATH | Probable signal peptidase complex subunit 1 OS=Arabidopsis thaliana GN=At2g22425 PE=2 SV=1 | 17 | 83 | 2.0E-09 |
| sp|Q9VAL0|SPCS1_DROME | Signal peptidase complex subunit 1 OS=Drosophila melanogaster GN=Spase12 PE=1 SV=2 | 14 | 82 | 7.0E-08 |
| sp|G2TRR4|SPC1_SCHPO | Microsomal signal peptidase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=new19 PE=2 SV=1 | 14 | 82 | 1.0E-07 |
| sp|Q54Y83|SPCS1_DICDI | Signal peptidase complex subunit 1 OS=Dictyostelium discoideum GN=spcs1 PE=3 SV=1 | 17 | 82 | 4.0E-07 |
| sp|P46965|SPC1_YEAST | Signal peptidase complex subunit SPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC1 PE=1 SV=1 | 17 | 82 | 5.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006465 | signal peptide processing | Yes |
| GO:0016021 | integral component of membrane | Yes |
| GO:0005787 | signal peptidase complex | Yes |
| GO:0005575 | cellular_component | No |
| GO:1905368 | peptidase complex | No |
| GO:0019538 | protein metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0098796 | membrane protein complex | No |
| GO:0008150 | biological_process | No |
| GO:0031224 | intrinsic component of membrane | No |
| GO:0008152 | metabolic process | No |
| GO:0032991 | protein-containing complex | No |
| GO:0051604 | protein maturation | No |
| GO:0043603 | cellular amide metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0006518 | peptide metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0006508 | proteolysis | No |
| GO:1902494 | catalytic complex | No |
| GO:0140534 | endoplasmic reticulum protein-containing complex | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0016485 | protein processing | No |
| GO:0044237 | cellular metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 41 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 27 | 46 | 19 |
| 2 | 53 | 75 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|3287 MADQVLDKIRDVAEGTIDFDGQRRAEGLATLLLAMSGLLAFNIGFYFQDIVKALYTGLGGTAVTFLLIVPPWPFY NRNPVKWLPAGSGWQ* |
| Coding | >OphauG2|3287 ATGGCGGACCAAGTACTGGACAAGATCCGCGACGTGGCCGAAGGCACCATTGACTTCGATGGCCAGAGACGTGCC GAGGGGCTTGCTACGTTGCTACTTGCTATGTCTGGACTTTTGGCATTCAATATCGGCTTCTACTTCCAGGACATC GTGAAAGCCCTGTATACTGGACTGGGAGGGACTGCAGTAACGTTTCTGCTTATAGTACCGCCATGGCCATTCTAT AATAGAAATCCCGTCAAATGGCTCCCGGCTGGCTCTGGTTGGCAATAG |
| Transcript | >OphauG2|3287 ATGGCGGACCAAGTACTGGACAAGATCCGCGACGTGGCCGAAGGCACCATTGACTTCGATGGCCAGAGACGTGCC GAGGGGCTTGCTACGTTGCTACTTGCTATGTCTGGACTTTTGGCATTCAATATCGGCTTCTACTTCCAGGACATC GTGAAAGCCCTGTATACTGGACTGGGAGGGACTGCAGTAACGTTTCTGCTTATAGTACCGCCATGGCCATTCTAT AATAGAAATCCCGTCAAATGGCTCCCGGCTGGCTCTGGTTGGCAATAG |
| Gene | >OphauG2|3287 ATGGCGGACCAAGTACTGGACAAGATCCGCGACGTGGCCGAAGGCACCATTGTATGTGGGCTTAATCTAATGACT ATGGACTGCAAAACGCACAGATCACTGACATTTCTTTCTACTCCCAGGACTTCGATGGCCAGAGACGTGCCGAGG GGCTTGCTACGTTGCTACTTGCTATGTCTGGAGTACGCTCTCTCTGTCTCCCTCACTCTCCGCGGCCGAGCTCCA GACTCCCCACGCATGTAGCCGAGGGCTGACAGCATCTTCTCAACATATAGCTTTTGGCATTCAATATCGGCTTCT ACTTCCAGGACATCGTGAAAGCCCTGTATACTGGACTGGGAGGGACTGCAGTAACGTTTCTGCTTATAGTACCGC CATGGCCATTCTATAATAGAAATCCCGTCAAATGGCTCCCGGCTGGCTCTGGTTGGCAATAG |