Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|328
Gene name
LocationContig_1070:3227..5568
Strand-
Gene length (bp)2341
Transcript length (bp)2274
Coding sequence length (bp)2274
Protein length (aa) 758

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06602 Myotub-related Myotubularin-like phosphatase domain 5.9E-152 120 579

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 644 5.0E-152
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 647 5.0E-121
sp|Q9Z2C5|MTM1_MOUSE Myotubularin OS=Mus musculus GN=Mtm1 PE=1 SV=2 82 682 2.0E-92
sp|Q13496|MTM1_HUMAN Myotubularin OS=Homo sapiens GN=MTM1 PE=1 SV=2 82 646 5.0E-92
sp|Q9Y216|MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens GN=MTMR7 PE=1 SV=3 21 643 1.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 644 5.0E-152
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 647 5.0E-121
sp|Q9Z2C5|MTM1_MOUSE Myotubularin OS=Mus musculus GN=Mtm1 PE=1 SV=2 82 682 2.0E-92
sp|Q13496|MTM1_HUMAN Myotubularin OS=Homo sapiens GN=MTM1 PE=1 SV=2 82 646 5.0E-92
sp|Q9Y216|MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens GN=MTMR7 PE=1 SV=3 21 643 1.0E-91
sp|Q5R9S3|MTM1_PONAB Myotubularin OS=Pongo abelii GN=MTM1 PE=2 SV=1 82 646 2.0E-91
sp|Q5R6F6|MTMR7_PONAB Myotubularin-related protein 7 OS=Pongo abelii GN=MTMR7 PE=2 SV=1 21 643 3.0E-91
sp|Q9Z2C9|MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus GN=Mtmr7 PE=1 SV=2 21 638 7.0E-91
sp|Q6AXQ4|MTM1_RAT Myotubularin OS=Rattus norvegicus GN=Mtm1 PE=2 SV=2 82 646 2.0E-90
sp|Q5EB32|MTM1_XENTR Myotubularin OS=Xenopus tropicalis GN=mtm1 PE=2 SV=1 82 646 8.0E-90
sp|Q52KU6|MTM1_XENLA Myotubularin OS=Xenopus laevis GN=mtm1 PE=2 SV=1 82 646 2.0E-89
sp|Q5F452|MTMR8_CHICK Myotubularin-related protein 8 OS=Gallus gallus GN=MTMR8 PE=2 SV=1 20 607 2.0E-89
sp|A6QLT4|MTM1_BOVIN Myotubularin OS=Bos taurus GN=MTM1 PE=2 SV=2 82 646 1.0E-87
sp|Q8VE11|MTMR6_MOUSE Myotubularin-related protein 6 OS=Mus musculus GN=Mtmr6 PE=1 SV=1 82 609 1.0E-87
sp|Q9Y217|MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens GN=MTMR6 PE=1 SV=3 82 609 5.0E-86
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 20 456 1.0E-73
sp|Q13614|MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens GN=MTMR2 PE=1 SV=4 120 459 1.0E-72
sp|Q9Z2D1|MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus GN=Mtmr2 PE=1 SV=3 120 459 3.0E-72
sp|A6QLT2|MTMR2_BOVIN Myotubularin-related protein 2 OS=Bos taurus GN=MTMR2 PE=2 SV=1 84 459 8.0E-72
sp|Q5REB9|MTMR2_PONAB Myotubularin-related protein 2 OS=Pongo abelii GN=MTMR2 PE=2 SV=1 120 459 9.0E-72
sp|Q5ZIV1|MTMR2_CHICK Myotubularin-related protein 2 OS=Gallus gallus GN=MTMR2 PE=2 SV=1 80 459 1.0E-70
sp|Q9Z2C4|MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus GN=Mtmr1 PE=1 SV=1 80 459 2.0E-66
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens GN=MTMR1 PE=1 SV=4 80 456 3.0E-66
sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 82 456 2.0E-65
sp|A0JMK5|MTMR2_DANRE Myotubularin-related protein 2 OS=Danio rerio GN=mtmr2 PE=2 SV=2 96 459 2.0E-64
sp|Q8K296|MTMR3_MOUSE Myotubularin-related protein 3 OS=Mus musculus GN=Mtmr3 PE=1 SV=2 80 609 6.0E-64
sp|F4J3T8|MYTM1_ARATH Phosphatidylinositol-3-phosphatase myotubularin-1 OS=Arabidopsis thaliana GN=MTM1 PE=1 SV=1 155 595 2.0E-63
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 80 609 3.0E-59
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 82 609 5.0E-59
sp|F4JWB3|MYTM2_ARATH Phosphatidylinositol-3-phosphatase myotubularin-2 OS=Arabidopsis thaliana GN=MTM2 PE=1 SV=1 155 456 3.0E-55
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 74 459 3.0E-51
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 74 454 3.0E-51
sp|Q7ZXF1|MTMR4_XENLA Myotubularin-related protein 4 OS=Xenopus laevis GN=mtmr4 PE=2 SV=1 74 459 1.0E-49
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 79 454 1.0E-42
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 79 454 1.0E-42
sp|Q22712|MTMR3_CAEEL Myotubularin-related protein 3 OS=Caenorhabditis elegans GN=mtm-3 PE=1 SV=2 145 641 1.0E-41
sp|Q2KJ24|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus GN=MTMR9 PE=2 SV=1 21 454 8.0E-36
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 160 454 5.0E-21
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 160 451 2.0E-20
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 339 454 2.0E-20
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 525 662 6.0E-19
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 73 240 7.0E-19
sp|A0JMK5|MTMR2_DANRE Myotubularin-related protein 2 OS=Danio rerio GN=mtmr2 PE=2 SV=2 528 631 2.0E-17
sp|Q13614|MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens GN=MTMR2 PE=1 SV=4 528 609 3.0E-17
sp|Q5REB9|MTMR2_PONAB Myotubularin-related protein 2 OS=Pongo abelii GN=MTMR2 PE=2 SV=1 528 609 3.0E-17
sp|Q5ZIV1|MTMR2_CHICK Myotubularin-related protein 2 OS=Gallus gallus GN=MTMR2 PE=2 SV=1 528 607 4.0E-17
sp|A6QLT2|MTMR2_BOVIN Myotubularin-related protein 2 OS=Bos taurus GN=MTMR2 PE=2 SV=1 528 609 4.0E-17
sp|Q9Z2D1|MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus GN=Mtmr2 PE=1 SV=3 528 609 8.0E-17
sp|Q9Z2C4|MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus GN=Mtmr1 PE=1 SV=1 528 605 1.0E-16
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens GN=MTMR1 PE=1 SV=4 528 647 2.0E-16
sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 524 644 1.0E-15
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 371 454 4.0E-15
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 371 451 6.0E-15
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 376 461 1.0E-14
sp|A2BGG1|MTMRC_DANRE Myotubularin-related protein 12 OS=Danio rerio GN=mtmr12 PE=3 SV=1 371 459 5.0E-14
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 522 609 7.0E-14
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 521 609 1.0E-13
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 529 612 1.0E-11
sp|Q9NXD2|MTMRA_HUMAN Myotubularin-related protein 10 OS=Homo sapiens GN=MTMR10 PE=1 SV=3 371 459 1.0E-11
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 529 612 3.0E-11
sp|Q7ZXF1|MTMR4_XENLA Myotubularin-related protein 4 OS=Xenopus laevis GN=mtmr4 PE=2 SV=1 529 607 9.0E-11
sp|Q7TPM9|MTMRA_MOUSE Myotubularin-related protein 10 OS=Mus musculus GN=Mtmr10 PE=1 SV=2 371 459 1.0E-09
sp|Q2KJ24|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus GN=MTMR9 PE=2 SV=1 524 592 2.0E-09
sp|Q5FVM6|MTMRC_RAT Myotubularin-related protein 12 OS=Rattus norvegicus GN=Mtmr12 PE=1 SV=2 370 459 2.0E-09
sp|A0JMF6|MTMRA_DANRE Myotubularin-related protein 10 OS=Danio rerio GN=mtmr10 PE=2 SV=1 371 459 3.0E-09
sp|Q9C0I1|MTMRC_HUMAN Myotubularin-related protein 12 OS=Homo sapiens GN=MTMR12 PE=1 SV=2 370 459 4.0E-09
sp|Q5U581|MTRAA_XENLA Myotubularin-related protein 10-A OS=Xenopus laevis GN=mtmr10-a PE=2 SV=1 371 459 4.0E-09
sp|Q5R989|MTMRC_PONAB Myotubularin-related protein 12 OS=Pongo abelii GN=MTMR12 PE=2 SV=1 370 459 4.0E-09
sp|Q6NU08|MTRAB_XENLA Myotubularin-related protein 10-B OS=Xenopus laevis GN=mtmr10-b PE=2 SV=1 371 459 5.0E-09
sp|Q80TA6|MTMRC_MOUSE Myotubularin-related protein 12 OS=Mus musculus GN=Mtmr12 PE=1 SV=2 370 459 9.0E-09
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 79 222 3.0E-08
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 528 607 8.0E-08
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 528 607 2.0E-07
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 529 595 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|328 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6927
Ophiocordyceps camponoti-floridani Ophcf2|01867
Ophiocordyceps camponoti-rufipedis Ophun1|6723
Ophiocordyceps kimflemingae Ophio5|8224
Ophiocordyceps subramaniannii Hirsu2|2351

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|328
MEARKVIHNVQGIYGGSTTNGILRLTDFHMVFCAPAAQANEDSSAPAVQCPPRERWLTFPMLCYCALRPTPSVSR
QAPSVRVRCRDFTFVMFNFVDNDVARDVFDFIKARTCRLGTVERLFAFSHKPLRKEQEVNGWEIYDPRAEFRRQG
ISEKLPDKGWRITNINKDHTFCDTYPAVLVVPSKISDNVLKYAREFRSRNRIPVLSYIHPINNCTITRSSQPLAG
ITRKTNVQDEKLVAASFSAWMPGSFEETQPDVSEGGTTPVADLSETERYEDEVLSRPTAMYDDKTGERIAYGRQQ
FNMIVDARPTINAMVNQVQGMGSENMDKYPFARKSFLSIENIHVMRNSLNKVVEALKDADVSPLPPNQELLNQSG
WLRHIQNVLGGSAIIARQIGIKHSNVLIHCSDGWDRTSQLSALAQIMLDPYYRTLEGFIVLIEKDWLSFGHMFRL
RCGHLNHEDWFVVQKDAFAGSKVHPGDSDGRNDALQNVLSGAKRFFNQSKDDADPSAISEAASGKVVDDEATTPK
MVSPVFHQFLDCTYQLLRQNKERFEFNERFLRRLLYHLYSCQYGTFLFNSEKQRVDAKAKERTSSVWDYFLCRKA
EFSNPEYDATIDDRTRGRERLLLPKLKEIRWWHQLFGRSDDEMNSQLNAAALAEVDRQATVLGLNSAGSSNTPRC
TSASPALPGYGSSSSVLAAVETSHEALNLADSPTRRHHTLSNIHHNFTTLSVVGNKLSNLHGSYDASSSSSHRND
EELQEMT*
Coding >OphauG2|328
ATGGAGGCGAGAAAGGTCATTCACAATGTTCAAGGCATTTACGGAGGCTCAACTACCAATGGAATCCTGCGACTC
ACAGACTTTCACATGGTTTTTTGTGCCCCAGCAGCCCAGGCGAATGAGGACTCTTCTGCTCCAGCTGTACAGTGT
CCGCCACGCGAGCGGTGGCTTACCTTCCCCATGCTATGCTACTGCGCTCTACGGCCCACTCCCTCTGTCTCCCGC
CAGGCACCATCTGTTCGAGTCCGTTGTCGAGACTTTACCTTTGTCATGTTTAACTTTGTCGATAACGATGTGGCA
CGGGACGTCTTCGATTTCATCAAGGCACGGACTTGCAGGCTCGGCACTGTCGAACGGCTCTTTGCCTTTAGTCAT
AAGCCTCTGAGGAAAGAACAAGAGGTAAATGGCTGGGAAATTTACGACCCCAGGGCAGAGTTCAGGAGGCAAGGC
ATCAGCGAAAAACTCCCGGACAAAGGATGGAGGATAACAAACATCAACAAGGATCATACCTTCTGCGATACCTAT
CCCGCTGTCCTGGTAGTTCCTTCCAAGATATCAGACAATGTCCTCAAGTATGCCAGGGAGTTTCGCTCCCGAAAT
CGAATCCCCGTACTATCATATATCCACCCAATCAATAATTGTACCATTACGAGGAGCTCTCAACCGCTGGCTGGC
ATCACCCGCAAAACAAACGTTCAAGACGAGAAGCTTGTTGCAGCCTCTTTCTCCGCATGGATGCCAGGTAGCTTT
GAAGAGACGCAGCCTGATGTTTCTGAAGGCGGCACGACGCCAGTTGCAGATCTATCCGAGACAGAGCGCTACGAG
GACGAGGTCTTGTCACGCCCAACGGCCATGTATGACGACAAAACTGGTGAGAGAATCGCATATGGCCGCCAGCAG
TTTAACATGATTGTCGATGCTCGGCCAACCATCAACGCCATGGTCAATCAGGTCCAAGGCATGGGGTCCGAGAAT
ATGGATAAATATCCGTTTGCTAGGAAGTCTTTTCTGAGCATTGAAAATATTCACGTCATGCGTAACTCTCTCAAC
AAGGTTGTCGAGGCTCTCAAGGATGCCGATGTCTCTCCCCTGCCTCCAAACCAGGAACTTCTTAACCAGAGTGGC
TGGTTGCGTCACATCCAAAACGTCCTTGGCGGCTCGGCCATTATAGCTCGCCAGATTGGAATCAAGCACTCGAAT
GTTCTCATTCATTGCTCAGACGGCTGGGACCGCACCAGCCAATTAAGCGCTTTGGCTCAGATTATGCTTGATCCC
TATTACCGTACCCTCGAGGGATTCATTGTGCTTATTGAAAAGGACTGGTTGTCGTTTGGTCACATGTTCCGGCTT
CGCTGTGGACACCTCAACCATGAGGATTGGTTTGTGGTGCAGAAGGATGCATTTGCCGGATCCAAGGTGCATCCT
GGAGACAGTGATGGGCGAAACGATGCGCTTCAGAATGTCCTGAGCGGTGCCAAACGCTTCTTTAACCAGAGCAAG
GATGACGCCGATCCCTCTGCTATTAGTGAGGCAGCATCTGGAAAGGTTGTGGACGACGAGGCCACGACGCCCAAA
ATGGTCAGTCCTGTATTTCACCAATTTCTCGACTGTACCTACCAGCTTCTACGCCAGAACAAGGAGCGCTTCGAG
TTCAATGAGCGCTTCTTGCGCCGACTATTGTATCATCTTTATTCTTGCCAATATGGAACCTTTTTGTTCAACTCT
GAGAAACAAAGGGTAGACGCCAAGGCAAAAGAAAGAACGTCGTCAGTCTGGGACTATTTTCTCTGCCGAAAGGCC
GAATTCAGCAATCCTGAATACGATGCTACCATTGATGATCGAACAAGAGGCCGCGAGCGTTTGCTGCTCCCCAAA
CTCAAGGAGATTAGATGGTGGCACCAGCTCTTTGGCAGGAGCGATGACGAGATGAACTCACAGCTCAATGCGGCA
GCCCTAGCCGAAGTTGATCGCCAGGCAACAGTCTTGGGCCTGAATTCAGCTGGCTCAAGTAATACGCCGAGATGC
ACTTCTGCATCTCCAGCGCTTCCTGGATATGGCTCCAGCTCTTCTGTTCTTGCTGCTGTTGAGACGTCCCATGAG
GCGCTAAATCTGGCTGATTCACCGACTCGTCGACACCATACCCTTTCCAATATACATCACAACTTTACGACGTTG
AGCGTCGTCGGGAACAAGCTCTCCAATCTCCATGGCAGCTATGATGCTTCATCGAGCTCGTCCCATCGCAATGAC
GAGGAACTGCAAGAAATGACATAG
Transcript >OphauG2|328
ATGGAGGCGAGAAAGGTCATTCACAATGTTCAAGGCATTTACGGAGGCTCAACTACCAATGGAATCCTGCGACTC
ACAGACTTTCACATGGTTTTTTGTGCCCCAGCAGCCCAGGCGAATGAGGACTCTTCTGCTCCAGCTGTACAGTGT
CCGCCACGCGAGCGGTGGCTTACCTTCCCCATGCTATGCTACTGCGCTCTACGGCCCACTCCCTCTGTCTCCCGC
CAGGCACCATCTGTTCGAGTCCGTTGTCGAGACTTTACCTTTGTCATGTTTAACTTTGTCGATAACGATGTGGCA
CGGGACGTCTTCGATTTCATCAAGGCACGGACTTGCAGGCTCGGCACTGTCGAACGGCTCTTTGCCTTTAGTCAT
AAGCCTCTGAGGAAAGAACAAGAGGTAAATGGCTGGGAAATTTACGACCCCAGGGCAGAGTTCAGGAGGCAAGGC
ATCAGCGAAAAACTCCCGGACAAAGGATGGAGGATAACAAACATCAACAAGGATCATACCTTCTGCGATACCTAT
CCCGCTGTCCTGGTAGTTCCTTCCAAGATATCAGACAATGTCCTCAAGTATGCCAGGGAGTTTCGCTCCCGAAAT
CGAATCCCCGTACTATCATATATCCACCCAATCAATAATTGTACCATTACGAGGAGCTCTCAACCGCTGGCTGGC
ATCACCCGCAAAACAAACGTTCAAGACGAGAAGCTTGTTGCAGCCTCTTTCTCCGCATGGATGCCAGGTAGCTTT
GAAGAGACGCAGCCTGATGTTTCTGAAGGCGGCACGACGCCAGTTGCAGATCTATCCGAGACAGAGCGCTACGAG
GACGAGGTCTTGTCACGCCCAACGGCCATGTATGACGACAAAACTGGTGAGAGAATCGCATATGGCCGCCAGCAG
TTTAACATGATTGTCGATGCTCGGCCAACCATCAACGCCATGGTCAATCAGGTCCAAGGCATGGGGTCCGAGAAT
ATGGATAAATATCCGTTTGCTAGGAAGTCTTTTCTGAGCATTGAAAATATTCACGTCATGCGTAACTCTCTCAAC
AAGGTTGTCGAGGCTCTCAAGGATGCCGATGTCTCTCCCCTGCCTCCAAACCAGGAACTTCTTAACCAGAGTGGC
TGGTTGCGTCACATCCAAAACGTCCTTGGCGGCTCGGCCATTATAGCTCGCCAGATTGGAATCAAGCACTCGAAT
GTTCTCATTCATTGCTCAGACGGCTGGGACCGCACCAGCCAATTAAGCGCTTTGGCTCAGATTATGCTTGATCCC
TATTACCGTACCCTCGAGGGATTCATTGTGCTTATTGAAAAGGACTGGTTGTCGTTTGGTCACATGTTCCGGCTT
CGCTGTGGACACCTCAACCATGAGGATTGGTTTGTGGTGCAGAAGGATGCATTTGCCGGATCCAAGGTGCATCCT
GGAGACAGTGATGGGCGAAACGATGCGCTTCAGAATGTCCTGAGCGGTGCCAAACGCTTCTTTAACCAGAGCAAG
GATGACGCCGATCCCTCTGCTATTAGTGAGGCAGCATCTGGAAAGGTTGTGGACGACGAGGCCACGACGCCCAAA
ATGGTCAGTCCTGTATTTCACCAATTTCTCGACTGTACCTACCAGCTTCTACGCCAGAACAAGGAGCGCTTCGAG
TTCAATGAGCGCTTCTTGCGCCGACTATTGTATCATCTTTATTCTTGCCAATATGGAACCTTTTTGTTCAACTCT
GAGAAACAAAGGGTAGACGCCAAGGCAAAAGAAAGAACGTCGTCAGTCTGGGACTATTTTCTCTGCCGAAAGGCC
GAATTCAGCAATCCTGAATACGATGCTACCATTGATGATCGAACAAGAGGCCGCGAGCGTTTGCTGCTCCCCAAA
CTCAAGGAGATTAGATGGTGGCACCAGCTCTTTGGCAGGAGCGATGACGAGATGAACTCACAGCTCAATGCGGCA
GCCCTAGCCGAAGTTGATCGCCAGGCAACAGTCTTGGGCCTGAATTCAGCTGGCTCAAGTAATACGCCGAGATGC
ACTTCTGCATCTCCAGCGCTTCCTGGATATGGCTCCAGCTCTTCTGTTCTTGCTGCTGTTGAGACGTCCCATGAG
GCGCTAAATCTGGCTGATTCACCGACTCGTCGACACCATACCCTTTCCAATATACATCACAACTTTACGACGTTG
AGCGTCGTCGGGAACAAGCTCTCCAATCTCCATGGCAGCTATGATGCTTCATCGAGCTCGTCCCATCGCAATGAC
GAGGAACTGCAAGAAATGACATAG
Gene >OphauG2|328
ATGGAGGCGAGAAAGGTACGTGCTTCACAGTTCAGTCTTTATTTGCAACTGGCATTGTGAGCAGCATCCTGACCA
TGGTCAGGTCATTCACAATGTTCAAGGCATTTACGGAGGCTCAACTACCAATGGAATCCTGCGACTCACAGACTT
TCACATGGTTTTTTGTGCCCCAGCAGCCCAGGCGAATGAGGACTCTTCTGCTCCAGCTGTACAGTGTCCGCCACG
CGAGCGGTGGCTTACCTTCCCCATGCTATGCTACTGCGCTCTACGGCCCACTCCCTCTGTCTCCCGCCAGGCACC
ATCTGTTCGAGTCCGTTGTCGAGACTTTACCTTTGTCATGTTTAACTTTGTCGATAACGATGTGGCACGGGACGT
CTTCGATTTCATCAAGGCACGGACTTGCAGGCTCGGCACTGTCGAACGGCTCTTTGCCTTTAGTCATAAGCCTCT
GAGGAAAGAACAAGAGGTAAATGGCTGGGAAATTTACGACCCCAGGGCAGAGTTCAGGAGGCAAGGCATCAGCGA
AAAACTCCCGGACAAAGGATGGAGGATAACAAACATCAACAAGGATCATACCTTCTGCGATACCTATCCCGCTGT
CCTGGTAGTTCCTTCCAAGATATCAGACAATGTCCTCAAGTATGCCAGGGAGTTTCGCTCCCGAAATCGAATCCC
CGTACTATCATATATCCACCCAATCAATAATTGTACCATTACGAGGAGCTCTCAACCGCTGGCTGGCATCACCCG
CAAAACAAACGTTCAAGACGAGAAGCTTGTTGCAGCCTCTTTCTCCGCATGGATGCCAGGTAGCTTTGAAGAGAC
GCAGCCTGATGTTTCTGAAGGCGGCACGACGCCAGTTGCAGATCTATCCGAGACAGAGCGCTACGAGGACGAGGT
CTTGTCACGCCCAACGGCCATGTATGACGACAAAACTGGTGAGAGAATCGCATATGGCCGCCAGCAGTTTAACAT
GATTGTCGATGCTCGGCCAACCATCAACGCCATGGTCAATCAGGTCCAAGGCATGGGGTCCGAGAATATGGATAA
ATATCCGTTTGCTAGGAAGTCTTTTCTGAGCATTGAAAATATTCACGTCATGCGTAACTCTCTCAACAAGGTTGT
CGAGGCTCTCAAGGATGCCGATGTCTCTCCCCTGCCTCCAAACCAGGAACTTCTTAACCAGAGTGGCTGGTTGCG
TCACATCCAAAACGTCCTTGGCGGCTCGGCCATTATAGCTCGCCAGATTGGAATCAAGCACTCGAATGTTCTCAT
TCATTGCTCAGACGGCTGGGACCGCACCAGCCAATTAAGCGCTTTGGCTCAGATTATGCTTGATCCCTATTACCG
TACCCTCGAGGGATTCATTGTGCTTATTGAAAAGGACTGGTTGTCGTTTGGTCACATGTTCCGGCTTCGCTGTGG
ACACCTCAACCATGAGGATTGGTTTGTGGTGCAGAAGGATGCATTTGCCGGATCCAAGGTGCATCCTGGAGACAG
TGATGGGCGAAACGATGCGCTTCAGAATGTCCTGAGCGGTGCCAAACGCTTCTTTAACCAGAGCAAGGATGACGC
CGATCCCTCTGCTATTAGTGAGGCAGCATCTGGAAAGGTTGTGGACGACGAGGCCACGACGCCCAAAATGGTCAG
TCCTGTATTTCACCAATTTCTCGACTGTACCTACCAGCTTCTACGCCAGAACAAGGAGCGCTTCGAGTTCAATGA
GCGCTTCTTGCGCCGACTATTGTATCATCTTTATTCTTGCCAATATGGAACCTTTTTGTTCAACTCTGAGAAACA
AAGGGTAGACGCCAAGGCAAAAGAAAGAACGTCGTCAGTCTGGGACTATTTTCTCTGCCGAAAGGCCGAATTCAG
CAATCCTGAATACGATGCTACCATTGATGATCGAACAAGAGGCCGCGAGCGTTTGCTGCTCCCCAAACTCAAGGA
GATTAGATGGTGGCACCAGCTCTTTGGCAGGAGCGATGACGAGATGAACTCACAGCTCAATGCGGCAGCCCTAGC
CGAAGTTGATCGCCAGGCAACAGTCTTGGGCCTGAATTCAGCTGGCTCAAGTAATACGCCGAGATGCACTTCTGC
ATCTCCAGCGCTTCCTGGATATGGCTCCAGCTCTTCTGTTCTTGCTGCTGTTGAGACGTCCCATGAGGCGCTAAA
TCTGGCTGATTCACCGACTCGTCGACACCATACCCTTTCCAATATACATCACAACTTTACGACGTTGAGCGTCGT
CGGGAACAAGCTCTCCAATCTCCATGGCAGCTATGATGCTTCATCGAGCTCGTCCCATCGCAATGACGAGGAACT
GCAAGAAATGACATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail