Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3273
Gene name
LocationContig_244:8433..12210
Strand+
Gene length (bp)3777
Transcript length (bp)3219
Coding sequence length (bp)3219
Protein length (aa) 1073

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 7.3E-16 219 402
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 2.7E-05 82 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12496|YO098_YEAST Uncharacterized protein YOL098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL098C PE=1 SV=1 30 1025 5.0E-179
sp|Q10068|YAN2_SCHPO Uncharacterized protein C3H1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.02c PE=4 SV=1 45 1045 1.0E-161
sp|P48053|YPD1_CAEEL Uncharacterized protein C05D11.1 OS=Caenorhabditis elegans GN=C05D11.1 PE=4 SV=2 49 983 3.0E-103
sp|Q9LJL3|PREP1_ARATH Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP1 PE=1 SV=2 49 907 2.0E-27
sp|Q8VY06|PREP2_ARATH Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP2 PE=1 SV=1 4 907 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12496|YO098_YEAST Uncharacterized protein YOL098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL098C PE=1 SV=1 30 1025 5.0E-179
sp|Q10068|YAN2_SCHPO Uncharacterized protein C3H1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.02c PE=4 SV=1 45 1045 1.0E-161
sp|P48053|YPD1_CAEEL Uncharacterized protein C05D11.1 OS=Caenorhabditis elegans GN=C05D11.1 PE=4 SV=2 49 983 3.0E-103
sp|Q9LJL3|PREP1_ARATH Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP1 PE=1 SV=2 49 907 2.0E-27
sp|Q8VY06|PREP2_ARATH Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP2 PE=1 SV=1 4 907 2.0E-22
sp|Q5JRX3|PREP_HUMAN Presequence protease, mitochondrial OS=Homo sapiens GN=PITRM1 PE=1 SV=3 69 617 5.0E-17
sp|Q5RDG3|PREP_PONAB Presequence protease, mitochondrial OS=Pongo abelii GN=PITRM1 PE=2 SV=1 45 617 2.0E-16
sp|Q28BR5|PREP_XENTR Presequence protease, mitochondrial OS=Xenopus tropicalis GN=pitrm1 PE=2 SV=1 69 412 2.0E-15
sp|Q7ZVZ6|PREP_DANRE Presequence protease, mitochondrial OS=Danio rerio GN=pitrm1 PE=2 SV=1 76 278 5.0E-15
sp|Q7S7C0|CYM1_NEUCR Mitochondrial presequence protease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cym-1 PE=3 SV=1 80 265 2.0E-14
sp|Q4IA56|CYM1_GIBZE Mitochondrial presequence protease OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYM1 PE=3 SV=1 80 1008 4.0E-14
sp|Q6PF24|PREP_XENLA Presequence protease, mitochondrial OS=Xenopus laevis GN=pitrm1 PE=2 SV=1 69 412 6.0E-14
sp|Q8K411|PREP_MOUSE Presequence protease, mitochondrial OS=Mus musculus GN=Pitrm1 PE=1 SV=1 69 617 1.0E-13
sp|Q759T9|CYM1_ASHGO Mitochondrial presequence protease OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CYM1 PE=3 SV=2 80 353 2.0E-13
sp|Q46205|HYPA_CLOPE Protein HypA OS=Clostridium perfringens (strain 13 / Type A) GN=hypA PE=4 SV=2 80 406 4.0E-13
sp|Q5B6H7|CYM1_EMENI Mitochondrial presequence protease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cym1 PE=3 SV=1 80 406 5.0E-13
sp|Q9V9E3|PREP_DROME Presequence protease, mitochondrial OS=Drosophila melanogaster GN=CG3107 PE=2 SV=2 52 279 1.0E-12
sp|O42908|CYM1_SCHPO Mitochondrial presequence protease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cym1 PE=3 SV=1 58 256 2.0E-12
sp|Q5A301|CYM1_CANAL Mitochondrial presequence protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYM1 PE=3 SV=1 69 275 2.0E-12
sp|Q6BTC0|CYM1_DEBHA Mitochondrial presequence protease OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CYM1 PE=3 SV=2 53 261 4.0E-12
sp|Q2UGN1|CYM1_ASPOR Mitochondrial presequence protease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cym1 PE=3 SV=1 80 344 2.0E-11
sp|O51246|Y228_BORBU Uncharacterized protein BB_0228 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0228 PE=4 SV=1 49 342 3.0E-11
sp|P31828|PQQL_ECOLI Probable zinc protease PqqL OS=Escherichia coli (strain K12) GN=pqqL PE=3 SV=2 54 256 4.0E-11
sp|Q4WP38|CYM1_ASPFU Mitochondrial presequence protease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cym1 PE=3 SV=1 80 344 6.0E-11
sp|Q6CWW6|CYM1_KLULA Mitochondrial presequence protease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CYM1 PE=3 SV=1 80 255 8.0E-11
sp|Q6C0U8|CYM1_YARLI Mitochondrial presequence protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CYM1 PE=3 SV=1 80 251 1.0E-09
sp|O86835|Y5738_STRCO Uncharacterized zinc protease SCO5738 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5738 PE=3 SV=1 82 400 3.0E-08
sp|P32898|CYM1_YEAST Mitochondrial presequence protease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYM1 PE=1 SV=2 45 256 7.0E-08
sp|P45181|PQQL_HAEIN Probable zinc protease PqqL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pqqL PE=3 SV=1 54 327 1.0E-06
sp|Q6FUI7|CYM1_CANGA Mitochondrial presequence protease OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CYM1 PE=3 SV=1 45 256 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1766
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3273 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7948
Ophiocordyceps camponoti-floridani Ophcf2|03513
Ophiocordyceps camponoti-rufipedis Ophun1|4610
Ophiocordyceps kimflemingae Ophio5|4892
Ophiocordyceps subramaniannii Hirsu2|1677

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3273
MPTNGQFKKVLVHHPKKPHAEAKVQIDSFGPRKVLSFKTDYAPCTITQYVSKRSGMRVIVADRKGPKINGYFTLA
TEIFDDSGAPHTLEHLIFMGSRSYRYKGLLDKLASRAYSSTNAWTATDHTAYTLDTAGWDGFAQVLPVYLEHIIL
PVITDEGIVTEVWHIDGEGNDAGVVYSEMQAVQFRSGEIMDLAARRLLYPENVGFRYETGGMTDALRVLSPDRIR
QFHRDMYQPRNLCLVIVGEADHQDLLRILDDFEESIKDDIPPMDTPFKRPWIDSPQPPTLQKTTITTVEFPEEDE
SVGEILVGFFGPPCTDLVATAALNVLLTYLCGSSVSVMENVLVEREELASSISNWWDSRPDSVIWIQPTGVATEK
LEFVEKRLFHLLKEVASKPLDMDYVKDCIRRERRQVKFLAETSESFYSNNIISDYLFGNRDGSTLSDMKTLSEYD
TLETWSDEDWRAFLTKWISDAHHVSILGKPSMSLASKMKSNEEARIANRKKELGPDGLERLGKRLEEAKAFNDRP
IPANIIDRWHVPGTESIHFIESDTARSGKARALGLGTGPAQKMLDGLPEGKLPLFIQFEDVPTNFVHITIHVGTS
QVPQVLKPLISIFSDLFFNTHIMRDGKLVNFEQVVMELEKDSIGYNLGSARALGDPDGLIIQFQTEPDKYAAAIN
WLRTMMFDSVYDPQRIKASVTKALADIPEFKRDGKGMAAEVDAALHLKRSTLSVAKRVMVRAIYLKRVKKLLQSD
PDKVVSWFKTIRSSLFSFGNMRILVTANLRNLPNSTTAWDSLSRLLDSSGDMEPIPKLISLLNEEGQKPGSVGAV
IIPMATLDSSYAVSSASSITSLLDPRFPAIMVAIGYLEAVEGPLWNAVRGAGYAYGSYFSRTIDSGILSYRIYRS
PDAFKAIVASRDAIRRIADGEVEIDRHLLQGTISQVVVMFADEQATMPSAALQNFVQGVVRELPSNWDKEILRRV
RDVSVEEMKSAMRDFILPCFEPGKSNVVITCAKLMSEGMQTAFKGMGYKVETHELSHFQDDYGLKGDDNNDDDEE
EQDDESYGTGDDDDYDEESEED*
Coding >OphauG2|3273
ATGCCAACCAACGGGCAATTCAAAAAGGTGTTGGTTCATCACCCGAAAAAGCCACACGCGGAAGCAAAGGTTCAG
ATCGACAGTTTCGGCCCTCGCAAGGTTCTTAGTTTCAAGACTGACTACGCTCCATGTACAATCACGCAATATGTC
TCGAAGCGCAGCGGAATGCGCGTCATTGTTGCAGACCGCAAGGGGCCCAAGATCAACGGCTACTTCACTCTTGCT
ACCGAAATCTTTGACGACTCTGGCGCGCCACACACCCTTGAGCACCTCATCTTCATGGGCTCCCGCAGCTACCGC
TACAAAGGCTTGCTGGACAAACTTGCCTCGCGTGCATACTCGTCAACCAATGCTTGGACCGCAACTGATCATACC
GCTTATACTCTAGACACAGCTGGCTGGGACGGCTTTGCCCAGGTCCTGCCCGTCTATCTCGAACACATCATCCTT
CCAGTTATAACAGACGAGGGCATTGTTACAGAGGTCTGGCACATTGACGGCGAGGGCAACGATGCTGGTGTTGTC
TACTCGGAAATGCAAGCTGTCCAGTTTCGCAGCGGCGAAATCATGGACCTTGCCGCTCGCCGTTTATTGTATCCT
GAAAATGTTGGCTTTCGTTACGAGACGGGCGGAATGACGGATGCCCTACGTGTTCTTAGTCCAGACCGCATCAGG
CAATTTCATCGCGATATGTATCAGCCCCGCAACCTGTGTCTAGTCATTGTTGGAGAGGCAGACCATCAAGACCTG
CTGCGCATCCTCGACGATTTCGAGGAGAGCATCAAGGACGACATTCCCCCTATGGATACCCCTTTCAAACGGCCC
TGGATCGACTCGCCCCAGCCACCCACCCTTCAAAAGACCACCATCACCACTGTAGAGTTTCCAGAAGAGGACGAG
TCAGTTGGCGAAATCTTGGTCGGATTTTTTGGACCTCCCTGTACCGATCTTGTCGCCACTGCAGCCCTCAATGTC
TTGCTGACGTATCTCTGCGGCTCATCAGTATCTGTCATGGAAAACGTGCTTGTTGAAAGGGAGGAGCTTGCCAGC
TCAATTTCCAACTGGTGGGACTCGAGGCCAGACTCCGTCATATGGATACAGCCTACTGGCGTAGCCACGGAAAAG
CTAGAGTTTGTCGAAAAGCGACTATTCCATCTGTTGAAAGAAGTGGCATCTAAGCCTCTTGATATGGACTATGTC
AAGGATTGCATCCGGCGTGAACGCCGTCAGGTCAAATTTCTGGCAGAAACCTCGGAATCCTTTTACTCCAACAAT
ATAATCTCGGACTATCTCTTCGGCAACCGCGATGGTTCGACATTGAGTGACATGAAAACACTCAGCGAGTACGAT
ACTTTGGAGACGTGGTCCGATGAGGACTGGCGCGCGTTTCTGACAAAGTGGATCTCGGACGCCCACCATGTCTCG
ATTCTTGGCAAGCCTTCAATGTCGCTGGCGTCCAAGATGAAGAGCAATGAGGAAGCTCGTATCGCTAATCGCAAG
AAGGAACTTGGGCCCGACGGCTTGGAGAGGCTGGGAAAGCGCCTAGAAGAAGCAAAGGCATTCAATGATCGACCT
ATTCCTGCAAATATCATTGACCGCTGGCATGTTCCGGGGACAGAATCCATACATTTTATTGAATCAGATACTGCG
CGTTCGGGCAAGGCGCGAGCTCTTGGACTCGGCACTGGACCAGCGCAGAAGATGCTTGATGGATTGCCAGAGGGA
AAACTGCCCCTTTTTATCCAGTTTGAGGATGTTCCCACGAATTTTGTGCACATAACCATACATGTGGGCACATCA
CAGGTGCCTCAAGTGCTGAAGCCACTCATATCCATCTTCAGCGACCTTTTCTTCAACACACACATCATGAGGGAT
GGCAAGCTGGTCAACTTTGAACAAGTGGTGATGGAGCTGGAAAAAGACAGCATTGGCTATAACCTGGGCTCTGCC
CGTGCTCTTGGCGACCCAGATGGCCTGATTATCCAATTTCAAACAGAGCCCGACAAGTACGCGGCCGCAATCAAC
TGGCTGCGCACCATGATGTTCGACTCGGTCTACGATCCTCAGCGAATCAAGGCATCAGTGACCAAGGCGCTGGCC
GACATACCCGAATTCAAGCGCGATGGCAAGGGAATGGCGGCCGAGGTTGATGCGGCGCTGCACTTGAAGAGGTCT
ACACTTAGTGTTGCGAAGCGTGTCATGGTGCGCGCCATCTACCTCAAGCGCGTCAAGAAACTTCTCCAAAGCGAC
CCTGACAAGGTTGTCTCTTGGTTCAAGACGATTCGCTCCTCTCTCTTTAGCTTTGGGAATATGCGCATTCTGGTG
ACGGCCAACCTGCGCAATCTTCCAAATTCCACAACTGCTTGGGACTCTCTATCCAGGCTGCTCGACTCGTCGGGG
GATATGGAACCAATACCCAAACTCATTAGCCTACTGAATGAGGAAGGACAGAAGCCTGGGTCTGTGGGCGCTGTG
ATTATTCCCATGGCTACTCTGGATAGCTCATATGCAGTCAGCTCTGCATCCAGTATCACATCGTTGTTGGATCCG
CGCTTCCCGGCAATCATGGTGGCCATTGGCTACCTAGAGGCTGTTGAAGGCCCCTTGTGGAACGCTGTTCGGGGC
GCAGGCTACGCCTACGGATCCTACTTTTCGCGCACCATCGACTCTGGGATTCTGTCATACCGCATCTACCGTTCA
CCCGATGCTTTCAAGGCAATTGTGGCGTCGCGGGATGCCATTCGTCGCATTGCTGATGGAGAGGTGGAGATTGAT
CGGCACTTGCTTCAAGGCACAATCAGCCAGGTGGTTGTCATGTTTGCCGACGAACAGGCGACCATGCCCAGCGCG
GCACTGCAAAACTTTGTGCAGGGTGTTGTCCGCGAGCTGCCGAGTAACTGGGACAAGGAGATTTTGCGCCGCGTC
CGCGATGTGTCTGTTGAGGAGATGAAGAGCGCAATGAGGGACTTTATCCTCCCTTGCTTTGAACCGGGCAAGAGC
AACGTGGTAATTACATGCGCGAAGCTCATGAGTGAGGGCATGCAAACTGCCTTCAAGGGCATGGGCTACAAAGTG
GAGACACACGAACTGAGCCACTTCCAAGACGATTATGGGCTCAAGGGTGACGACAACAATGATGATGATGAAGAG
GAACAAGACGACGAATCCTATGGCACAGGTGATGACGACGACTATGATGAAGAATCCGAAGAAGATTAA
Transcript >OphauG2|3273
ATGCCAACCAACGGGCAATTCAAAAAGGTGTTGGTTCATCACCCGAAAAAGCCACACGCGGAAGCAAAGGTTCAG
ATCGACAGTTTCGGCCCTCGCAAGGTTCTTAGTTTCAAGACTGACTACGCTCCATGTACAATCACGCAATATGTC
TCGAAGCGCAGCGGAATGCGCGTCATTGTTGCAGACCGCAAGGGGCCCAAGATCAACGGCTACTTCACTCTTGCT
ACCGAAATCTTTGACGACTCTGGCGCGCCACACACCCTTGAGCACCTCATCTTCATGGGCTCCCGCAGCTACCGC
TACAAAGGCTTGCTGGACAAACTTGCCTCGCGTGCATACTCGTCAACCAATGCTTGGACCGCAACTGATCATACC
GCTTATACTCTAGACACAGCTGGCTGGGACGGCTTTGCCCAGGTCCTGCCCGTCTATCTCGAACACATCATCCTT
CCAGTTATAACAGACGAGGGCATTGTTACAGAGGTCTGGCACATTGACGGCGAGGGCAACGATGCTGGTGTTGTC
TACTCGGAAATGCAAGCTGTCCAGTTTCGCAGCGGCGAAATCATGGACCTTGCCGCTCGCCGTTTATTGTATCCT
GAAAATGTTGGCTTTCGTTACGAGACGGGCGGAATGACGGATGCCCTACGTGTTCTTAGTCCAGACCGCATCAGG
CAATTTCATCGCGATATGTATCAGCCCCGCAACCTGTGTCTAGTCATTGTTGGAGAGGCAGACCATCAAGACCTG
CTGCGCATCCTCGACGATTTCGAGGAGAGCATCAAGGACGACATTCCCCCTATGGATACCCCTTTCAAACGGCCC
TGGATCGACTCGCCCCAGCCACCCACCCTTCAAAAGACCACCATCACCACTGTAGAGTTTCCAGAAGAGGACGAG
TCAGTTGGCGAAATCTTGGTCGGATTTTTTGGACCTCCCTGTACCGATCTTGTCGCCACTGCAGCCCTCAATGTC
TTGCTGACGTATCTCTGCGGCTCATCAGTATCTGTCATGGAAAACGTGCTTGTTGAAAGGGAGGAGCTTGCCAGC
TCAATTTCCAACTGGTGGGACTCGAGGCCAGACTCCGTCATATGGATACAGCCTACTGGCGTAGCCACGGAAAAG
CTAGAGTTTGTCGAAAAGCGACTATTCCATCTGTTGAAAGAAGTGGCATCTAAGCCTCTTGATATGGACTATGTC
AAGGATTGCATCCGGCGTGAACGCCGTCAGGTCAAATTTCTGGCAGAAACCTCGGAATCCTTTTACTCCAACAAT
ATAATCTCGGACTATCTCTTCGGCAACCGCGATGGTTCGACATTGAGTGACATGAAAACACTCAGCGAGTACGAT
ACTTTGGAGACGTGGTCCGATGAGGACTGGCGCGCGTTTCTGACAAAGTGGATCTCGGACGCCCACCATGTCTCG
ATTCTTGGCAAGCCTTCAATGTCGCTGGCGTCCAAGATGAAGAGCAATGAGGAAGCTCGTATCGCTAATCGCAAG
AAGGAACTTGGGCCCGACGGCTTGGAGAGGCTGGGAAAGCGCCTAGAAGAAGCAAAGGCATTCAATGATCGACCT
ATTCCTGCAAATATCATTGACCGCTGGCATGTTCCGGGGACAGAATCCATACATTTTATTGAATCAGATACTGCG
CGTTCGGGCAAGGCGCGAGCTCTTGGACTCGGCACTGGACCAGCGCAGAAGATGCTTGATGGATTGCCAGAGGGA
AAACTGCCCCTTTTTATCCAGTTTGAGGATGTTCCCACGAATTTTGTGCACATAACCATACATGTGGGCACATCA
CAGGTGCCTCAAGTGCTGAAGCCACTCATATCCATCTTCAGCGACCTTTTCTTCAACACACACATCATGAGGGAT
GGCAAGCTGGTCAACTTTGAACAAGTGGTGATGGAGCTGGAAAAAGACAGCATTGGCTATAACCTGGGCTCTGCC
CGTGCTCTTGGCGACCCAGATGGCCTGATTATCCAATTTCAAACAGAGCCCGACAAGTACGCGGCCGCAATCAAC
TGGCTGCGCACCATGATGTTCGACTCGGTCTACGATCCTCAGCGAATCAAGGCATCAGTGACCAAGGCGCTGGCC
GACATACCCGAATTCAAGCGCGATGGCAAGGGAATGGCGGCCGAGGTTGATGCGGCGCTGCACTTGAAGAGGTCT
ACACTTAGTGTTGCGAAGCGTGTCATGGTGCGCGCCATCTACCTCAAGCGCGTCAAGAAACTTCTCCAAAGCGAC
CCTGACAAGGTTGTCTCTTGGTTCAAGACGATTCGCTCCTCTCTCTTTAGCTTTGGGAATATGCGCATTCTGGTG
ACGGCCAACCTGCGCAATCTTCCAAATTCCACAACTGCTTGGGACTCTCTATCCAGGCTGCTCGACTCGTCGGGG
GATATGGAACCAATACCCAAACTCATTAGCCTACTGAATGAGGAAGGACAGAAGCCTGGGTCTGTGGGCGCTGTG
ATTATTCCCATGGCTACTCTGGATAGCTCATATGCAGTCAGCTCTGCATCCAGTATCACATCGTTGTTGGATCCG
CGCTTCCCGGCAATCATGGTGGCCATTGGCTACCTAGAGGCTGTTGAAGGCCCCTTGTGGAACGCTGTTCGGGGC
GCAGGCTACGCCTACGGATCCTACTTTTCGCGCACCATCGACTCTGGGATTCTGTCATACCGCATCTACCGTTCA
CCCGATGCTTTCAAGGCAATTGTGGCGTCGCGGGATGCCATTCGTCGCATTGCTGATGGAGAGGTGGAGATTGAT
CGGCACTTGCTTCAAGGCACAATCAGCCAGGTGGTTGTCATGTTTGCCGACGAACAGGCGACCATGCCCAGCGCG
GCACTGCAAAACTTTGTGCAGGGTGTTGTCCGCGAGCTGCCGAGTAACTGGGACAAGGAGATTTTGCGCCGCGTC
CGCGATGTGTCTGTTGAGGAGATGAAGAGCGCAATGAGGGACTTTATCCTCCCTTGCTTTGAACCGGGCAAGAGC
AACGTGGTAATTACATGCGCGAAGCTCATGAGTGAGGGCATGCAAACTGCCTTCAAGGGCATGGGCTACAAAGTG
GAGACACACGAACTGAGCCACTTCCAAGACGATTATGGGCTCAAGGGTGACGACAACAATGATGATGATGAAGAG
GAACAAGACGACGAATCCTATGGCACAGGTGATGACGACGACTATGATGAAGAATCCGAAGAAGATTAA
Gene >OphauG2|3273
ATGCCAACCAACGGGCAATTCAAAAAGGTGTTGGTTCATCACCCGGTAAGTACACACCCTCCTAATCTTATTGAG
CCTTCGCCTTGTCACGATATAAAATCTCGAGGTGCCCACCTTCACCCTGACTCTTCGTTGGCCAGAAAAAGCCAC
ACGCGGAAGCAAAGGTTCAGATCGACAGTTTCGGTGAGCTTCTCTCTTTACCTCGTCAAAATCACAGCCACCTGA
AAAATATCCCAAGTGGGTAGACTATTGCACACTTGTTGATAGGGCTCAATCTCTCCGGCAACCGTCACGTTACAC
AAACGTCAATCCTCTCCCTTTTGGAGTAATGCTGATGCAGCCATGCGACGTTGGTTCATCGCTTGGTCTTCCATC
GCCGCCTTTATCTCTTCCATTGGAACATCATCCTACGTCTGTACATAGCGTGCTGACCAATGATTGCAGGCCCTC
GGTCAACTAATAGATTCCGCCATCTAGTTGCTCCAAATGGCTTCCCGTGCTGCAAAGTCGAATTTCAGCAAGGTT
CTTAGTTTCAAGACTGACTACGCTCCATGTACAATCACGCAATATGTCTCGAAGCGCAGCGGAATGCGCGTCATT
GTTGCAGACCGCAAGGGGCCCAAGATCAACGGCTACTTCACTCTTGCTACCGAAATCTTTGACGACTCTGGCGCG
CCACACACCCTTGAGCACCTCATCTTCATGGGCTCCCGCAGCTACCGCTACAAAGGCTTGCTGGACAAACTTGCC
TCGCGTGCATACTCGTCAACCAATGCTTGGACCGCAACTGATCATACCGCTTATACTCTAGACACAGCTGGCTGG
GACGGCTTTGCCCAGGTCCTGCCCGTCTATCTCGAACACATCATCCTTCCAGTTATAACAGACGAGGGCATTGTT
ACAGAGGTCTGGCACATTGACGGCGAGGGCAACGATGCTGGTGTTGTCTACTCGGAAATGCAAGCTGTCCAGTTT
CGCAGCGGCGAAATCATGGACCTTGCCGCTCGCCGTTTATTGTATCCTGAAAATGTTGGCTTTCGTTACGAGACG
GGCGGAATGACGGATGCCCTACGTGTTCTTAGTCCAGACCGCATCAGGCAATTTCATCGCGATATGTATCAGCCC
CGCAACCTGTGTCTAGTCATTGTTGGAGAGGCAGACCATCAAGACCTGCTGCGCATCCTCGACGATTTCGAGGAG
AGCATCAAGGACGACATTCCCCCTATGGATACCCCTTTCAAACGGTAAGCCTGCTTCCAATCCATTATCAGCGCC
CCTAACCAAGCCCTAGGCCCTGGATCGACTCGCCCCAGCCACCCACCCTTCAAAAGACCACCATCACCACTGTAG
AGTTTCCAGAAGAGGACGAGTCAGTTGGCGAAATCTTGGTCGGATTTTTTGGACCTCCCTGTACCGATCTTGTCG
CCACTGCAGCCCTCAATGTCTTGCTGACGTATCTCTGCGGCTCATCAGTATCTGTCATGGAAAACGTGCTTGTTG
AAAGGGAGGAGCTTGCCAGCTCAATTTCCAACTGGTGGGACTCGAGGCCAGACTCCGTCATATGGATACAGCCTA
CTGGCGTAGCCACGGAAAAGCTAGAGTTTGTCGAAAAGCGACTATTCCATCTGTTGAAAGAAGTGGCATCTAAGC
CTCTTGATATGGACTATGTCAAGGATTGCATCCGGCGTGAACGCCGTCAGGTCAAATTTCTGGCAGAAACCTCGG
AATCCTTTTACTCCAACAATATAATCTCGGACTATCTCTTCGGCAACCGCGATGGTTCGACATTGAGTGACATGA
AAACACTCAGCGAGTACGATACTTTGGAGACGTGGTCCGATGAGGACTGGCGCGCGTTTCTGACAAAGTGGATCT
CGGACGCCCACCATGTCTCGATTCTTGGCAAGCCTTCAATGTCGCTGGCGTCCAAGATGAAGAGCAATGAGGAAG
CTCGTATCGCTAATCGCAAGAAGGAACTTGGGCCCGACGGCTTGGAGAGGCTGGGAAAGCGCCTAGAAGAAGCAA
AGGCATTCAATGATCGACCTATTCCTGCAAATATCATTGACCGCTGGCATGTTCCGGGGACAGAATCCATACATT
TTATTGAATCAGATACTGCGCGTTCGGGCAAGGCGCGAGCTCTTGGACTCGGCACTGGACCAGCGCAGAAGATGC
TTGATGGATTGCCAGAGGGAAAACTGCCCCTTTTTATCCAGTTTGAGGATGTTCCCACGAATTTTGTGCACATAA
CCATACATGTGGGCACATCACAGGTGCCTCAAGTGCTGAAGCCACTCATATCCATCTTCAGCGACCTTTTCTTCA
ACACACACATCATGAGGGATGGCAAGCTGGTCAACTTTGAACAAGTGGTGATGGAGCTGGAAAAAGACAGCATTG
GCTATAACCTGGGCTCTGCCCGTGCTCTTGGCGACCCAGATGGCCTGATTATCCAATTTCAAACAGAGCCCGACA
AGTACGCGGCCGCAATCAACTGGCTGCGCACCATGATGTTCGACTCGGTCTACGATCCTCAGCGAATCAAGGCAT
CAGTGACCAAGGCGCTGGCCGACATACCCGAATTCAAGCGCGATGGCAAGGGAATGGCGGCCGAGGTTGATGCGG
CGCTGCACTTGAAGAGGTCTACACTTAGTGTTGCGAAGCGTGTCATGGTGCGCGCCATCTACCTCAAGCGCGTCA
AGAAACTTCTCCAAAGCGACCCTGACAAGGTTGTCTCTTGGTTCAAGACGATTCGCTCCTCTCTCTTTAGCTTTG
GGAATATGCGCATTCTGGTGACGGCCAACCTGCGCAATCTTCCAAATTCCACAACTGCTTGGGACTCTCTATCCA
GGCTGCTCGACTCGTCGGGGGATATGGAACCAATACCCAAACTCATTAGCCTACTGAATGAGGAAGGACAGAAGC
CTGGGTCTGTGGGCGCTGTGATTATTCCCATGGCTACTCTGGATAGCTCATATGCAGTCAGCTCTGCATCCAGTA
TCACATCGTTGTTGGATCCGCGCTTCCCGGCAATCATGGTGGCCATTGGCTACCTAGAGGCTGTTGAAGGCCCCT
TGTGGAACGCTGTTCGGGGCGCAGGCTACGCCTACGGATCCTACTTTTCGCGCACCATCGACTCTGGGATTCTGT
CATACCGCATCTACCGTTCACCCGATGCTTTCAAGGCAATTGTGGCGTCGCGGGATGCCATTCGTCGCATTGCTG
ATGGAGAGGTGGAGATTGATCGGCACTTGCTTCAAGGCACAATCAGCCAGGTGGTTGTCATGTTTGCCGACGAAC
AGGCGACCATGCCCAGCGCGGCACTGCAAAACTTTGTGCAGGGTGTTGTCCGCGAGCTGCCGAGTAACTGGGACA
AGGAGATTTTGCGCCGCGTCCGCGATGTGTCTGTTGAGGAGATGAAGAGCGCAATGAGGGACTTTATCCTCCCTT
GCTTTGAACCGGGCAAGAGCAACGTGGTAATTACATGCGCGAAGCTCATGAGTGAGGTACGTCGAGTTTTTCTTT
TTCCCCTTGTTGTTTGCTCACCTTCTTGTGCCAAATATTATGGTGGTTTGGTTCGCTTACTGGAAATAGGGCATG
CAAACTGCCTTCAAGGGCATGGGCTACAAAGTGGAGACACACGAACTGAGCCACTTCCAAGACGATTATGGGCTC
AAGGGTGACGACAACAATGATGATGATGAAGAGGAACAAGACGACGAATCCTATGGCACAGGTGATGACGACGAC
TATGATGAAGAATCCGAAGAAGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail