Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3264
Gene name
LocationContig_243:2589..3588
Strand+
Gene length (bp)999
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 1.6E-12 12 238

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 71 275 4.0E-08

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3264
MPPIQPISLPRLILYYQTLHDPNGRHISLLPLLTQPSIAVTHLILAAIHINASPSDLTLNDHPPSHPRYHAVWAE
LRLLQASGIKVLAMLGGAAKGTYQRLDFPRPTDSDEPCIDRFHDFYPPLCNLLRHRGLDGIDLDVEEPMSLPGIM
RLIDRLRADFGPDFIITMAPVATALVDVEKNLSGFDYEALEVMRGAQIAWYNTQFYCGWGDLHTGSTALYHFILR
KGWPPSKVVIGLVTNPDNGSGFVPWSLLNLLLTSINRSHAGAFGGVMGWEYFNSMPGGTAEPWQWARHMSMLLRR
HALKSPSDSVSLHASLDAPLPHDFDYFSDTCD*
Coding >OphauG2|3264
ATGCCCCCAATCCAACCCATCAGCCTCCCCCGTCTCATCCTCTACTACCAGACGCTCCACGACCCAAACGGCCGC
CACATCTCTCTGCTGCCCCTCCTCACCCAGCCTTCCATTGCCGTCACCCACCTCATCCTCGCCGCCATCCACATC
AACGCCTCACCCTCGGACCTCACCCTCAATGACCACCCACCCAGCCATCCCCGCTACCACGCCGTCTGGGCCGAG
CTCCGCCTCCTTCAGGCCTCGGGCATCAAGGTCCTGGCCATGCTCGGCGGCGCTGCCAAGGGCACCTACCAGCGC
CTCGACTTTCCCCGCCCGACCGACTCGGACGAGCCCTGTATTGACCGCTTCCATGACTTTTACCCTCCCCTGTGC
AATCTGCTGCGCCACCGCGGCCTCGATGGCATCGATCTCGACGTCGAGGAGCCCATGAGCCTCCCGGGCATCATG
CGCCTCATTGACCGCCTGCGCGCAGATTTTGGCCCCGACTTCATCATCACAATGGCTCCCGTTGCCACAGCCCTT
GTCGACGTAGAAAAGAACCTGAGCGGCTTTGACTATGAGGCCCTCGAGGTGATGCGTGGTGCCCAAATAGCTTGG
TACAACACCCAGTTCTACTGCGGATGGGGAGACCTCCATACCGGCAGCACCGCATTGTACCACTTTATCCTTCGC
AAGGGTTGGCCCCCTTCCAAAGTCGTCATTGGCCTCGTTACAAATCCAGACAACGGATCAGGCTTTGTTCCCTGG
TCTCTCCTCAACCTCCTCCTAACTTCCATCAATCGTTCTCATGCCGGCGCCTTTGGCGGCGTCATGGGTTGGGAG
TACTTCAACAGCATGCCCGGCGGCACAGCTGAGCCCTGGCAATGGGCCCGCCACATGTCCATGCTCTTGAGACGC
CATGCCCTCAAATCTCCCTCTGATTCTGTTTCTCTCCATGCTTCTCTCGATGCTCCTCTCCCACATGACTTTGAC
TACTTTTCTGACACATGCGACTAG
Transcript >OphauG2|3264
ATGCCCCCAATCCAACCCATCAGCCTCCCCCGTCTCATCCTCTACTACCAGACGCTCCACGACCCAAACGGCCGC
CACATCTCTCTGCTGCCCCTCCTCACCCAGCCTTCCATTGCCGTCACCCACCTCATCCTCGCCGCCATCCACATC
AACGCCTCACCCTCGGACCTCACCCTCAATGACCACCCACCCAGCCATCCCCGCTACCACGCCGTCTGGGCCGAG
CTCCGCCTCCTTCAGGCCTCGGGCATCAAGGTCCTGGCCATGCTCGGCGGCGCTGCCAAGGGCACCTACCAGCGC
CTCGACTTTCCCCGCCCGACCGACTCGGACGAGCCCTGTATTGACCGCTTCCATGACTTTTACCCTCCCCTGTGC
AATCTGCTGCGCCACCGCGGCCTCGATGGCATCGATCTCGACGTCGAGGAGCCCATGAGCCTCCCGGGCATCATG
CGCCTCATTGACCGCCTGCGCGCAGATTTTGGCCCCGACTTCATCATCACAATGGCTCCCGTTGCCACAGCCCTT
GTCGACGTAGAAAAGAACCTGAGCGGCTTTGACTATGAGGCCCTCGAGGTGATGCGTGGTGCCCAAATAGCTTGG
TACAACACCCAGTTCTACTGCGGATGGGGAGACCTCCATACCGGCAGCACCGCATTGTACCACTTTATCCTTCGC
AAGGGTTGGCCCCCTTCCAAAGTCGTCATTGGCCTCGTTACAAATCCAGACAACGGATCAGGCTTTGTTCCCTGG
TCTCTCCTCAACCTCCTCCTAACTTCCATCAATCGTTCTCATGCCGGCGCCTTTGGCGGCGTCATGGGTTGGGAG
TACTTCAACAGCATGCCCGGCGGCACAGCTGAGCCCTGGCAATGGGCCCGCCACATGTCCATGCTCTTGAGACGC
CATGCCCTCAAATCTCCCTCTGATTCTGTTTCTCTCCATGCTTCTCTCGATGCTCCTCTCCCACATGACTTTGAC
TACTTTTCTGACACATGCGACTAG
Gene >OphauG2|3264
ATGCCCCCAATCCAACCCATCAGCCTCCCCCGTCTCATCCTCTACTACCAGACGCTCCACGACCCAAACGGCCGC
CACATCTCTCTGCTGCCCCTCCTCACCCAGCCTTCCATTGCCGTCACCCACCTCATCCTCGCCGCCATCCACATC
AACGCCTCACCCTCGGACCTCACCCTCAATGACCACCCACCCAGCCATCCCCGCTACCACGCCGTCTGGGCCGAG
CTCCGCCTCCTTCAGGCCTCGGGCATCAAGGTCCTGGCCATGCTCGGCGGCGCTGCCAAGGGCACCTACCAGCGC
CTCGACTTTCCCCGCCCGACCGACTCGGACGAGCCCTGTATTGACCGCTTCCATGACTTTTACCCTCCCCTGTGC
AATCTGCTGCGCCACCGCGGCCTCGATGGCATCGATCTCGACGTCGAGGAGCCCATGAGCCTCCCGGGCATCATG
CGCCTCATTGACCGCCTGCGCGCAGATTTTGGCCCCGACTTCATCATCACAATGGCTCCCGTTGCCACAGCCCTT
GTCGACGTAGAAAAGAACCTGAGCGGCTTTGACTATGAGGCCCTCGAGGTGATGCGTGGTGCCCAAATAGCTTGG
TACAACACCCAGTTCTACTGCGGATGGGGAGACCTCCATACCGGCAGCACCGCATTGTACCACTTTATCCTTCGC
AAGGGTTGGCCCCCTTCCAAAGTCGTCATTGGCCTCGTTACAAATCCAGACAACGGATCAGGCTTTGTTCCCTGG
TCTCTCCTCAACCTCCTCCTAACTTCCATCAATCGTTCTCATGCCGGCGCCTTTGGCGGCGTCATGGGTTGGGAG
TACTTCAACAGCATGCCCGGCGGCACAGCTGAGCCCTGGCAATGGGCCCGCCACATGTCCATGCTCTTGAGACGC
CATGCCCTCAAATCTCCCTCTGATTCTGTTTCTCTCCATGCTTCTCTCGATGCTCCTCTCCCACATGACTTTGAC
TACTTTTCTGACACATGCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail