Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3249
Gene name
LocationContig_241:8908..9629
Strand-
Gene length (bp)721
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01245 Ribosomal_L19 Ribosomal protein L19 2.2E-11 101 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT87|IMG1_SCHPO 54S ribosomal protein subunit img1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=img1 PE=3 SV=1 66 200 3.0E-18
sp|P25626|IMG1_YEAST 54S ribosomal protein IMG1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMG1 PE=1 SV=1 65 191 2.0E-09
sp|Q5FGP4|RL19_EHRRG 50S ribosomal protein L19 OS=Ehrlichia ruminantium (strain Gardel) GN=rplS PE=3 SV=2 74 180 4.0E-09
sp|Q5H9Z6|RL19_EHRRW 50S ribosomal protein L19 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rplS PE=3 SV=1 74 180 6.0E-09
sp|Q3YQP2|RL19_EHRCJ 50S ribosomal protein L19 OS=Ehrlichia canis (strain Jake) GN=rplS PE=3 SV=1 74 180 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT87|IMG1_SCHPO 54S ribosomal protein subunit img1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=img1 PE=3 SV=1 66 200 3.0E-18
sp|P25626|IMG1_YEAST 54S ribosomal protein IMG1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMG1 PE=1 SV=1 65 191 2.0E-09
sp|Q5FGP4|RL19_EHRRG 50S ribosomal protein L19 OS=Ehrlichia ruminantium (strain Gardel) GN=rplS PE=3 SV=2 74 180 4.0E-09
sp|Q5H9Z6|RL19_EHRRW 50S ribosomal protein L19 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rplS PE=3 SV=1 74 180 6.0E-09
sp|Q3YQP2|RL19_EHRCJ 50S ribosomal protein L19 OS=Ehrlichia canis (strain Jake) GN=rplS PE=3 SV=1 74 180 3.0E-07
sp|Q72JU9|RL19_THET2 50S ribosomal protein L19 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplS PE=1 SV=1 108 181 8.0E-07
sp|P60490|RL19_THET8 50S ribosomal protein L19 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplS PE=1 SV=2 108 181 1.0E-06
sp|B8HT34|RL19_CYAP4 50S ribosomal protein L19 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplS PE=3 SV=1 103 181 3.0E-06
sp|A4G2T8|RL19_HERAR 50S ribosomal protein L19 OS=Herminiimonas arsenicoxydans GN=rplS PE=3 SV=1 74 182 5.0E-06
sp|Q2L2Q1|RL19_BORA1 50S ribosomal protein L19 OS=Bordetella avium (strain 197N) GN=rplS PE=3 SV=1 109 182 6.0E-06
sp|A9KLM0|RL19_CLOPH 50S ribosomal protein L19 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplS PE=3 SV=1 99 195 8.0E-06
sp|B1Y0H8|RL19_LEPCP 50S ribosomal protein L19 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplS PE=3 SV=1 74 182 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2669
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3249 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7529
Ophiocordyceps camponoti-floridani Ophcf2|04905
Ophiocordyceps camponoti-rufipedis Ophun1|5791
Ophiocordyceps kimflemingae Ophio5|8297
Ophiocordyceps subramaniannii Hirsu2|4144

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3249
MRALIMRRPMGSFGAMNQRAKSPGIRQQCFATATHTPDKAPPTFYTTRQRKKHDKVARFQLWPQLPAVAPAYKDP
MPELQKQQIAQLDPTGARTRLFSRNEPDAAKVGDVLQVTSKLGEPFAGVMLQIRRRGVNTAIQLRGQLMRTSIEM
WYKIYSPTVKSIEIVWRRPKRARRARLTYMRKPKHDMGSVEDLVRSWRRQKYAMMSGAKRQDSLKKASKQ*
Coding >OphauG2|3249
ATGAGGGCTCTAATCATGCGACGGCCAATGGGCAGCTTCGGGGCCATGAACCAGCGGGCCAAGAGTCCTGGAATA
CGGCAACAATGCTTTGCAACCGCCACGCACACTCCTGACAAGGCTCCTCCTACATTCTACACCACGAGACAAAGA
AAGAAGCACGACAAGGTAGCCAGGTTTCAATTATGGCCTCAGCTTCCCGCTGTAGCTCCAGCGTACAAGGACCCG
ATGCCCGAGCTGCAGAAGCAACAAATCGCACAACTTGATCCAACTGGCGCAAGAACTCGCCTGTTTTCACGAAAT
GAGCCTGACGCGGCCAAAGTCGGGGACGTGCTTCAAGTCACGAGCAAGCTCGGTGAACCCTTTGCCGGCGTTATG
CTTCAAATACGGCGGCGAGGCGTCAACACGGCCATCCAGCTGCGAGGACAGCTAATGAGGACCAGCATCGAGATG
TGGTACAAGATTTACAGTCCAACCGTCAAGAGCATCGAGATTGTCTGGCGACGGCCGAAGCGGGCGCGGAGAGCA
AGGCTGACATATATGCGCAAGCCCAAGCACGACATGGGCAGCGTCGAGGACCTCGTGCGTTCTTGGAGGCGGCAA
AAATATGCCATGATGTCTGGCGCGAAGCGACAAGATTCTCTCAAAAAGGCCTCCAAGCAGTAG
Transcript >OphauG2|3249
ATGAGGGCTCTAATCATGCGACGGCCAATGGGCAGCTTCGGGGCCATGAACCAGCGGGCCAAGAGTCCTGGAATA
CGGCAACAATGCTTTGCAACCGCCACGCACACTCCTGACAAGGCTCCTCCTACATTCTACACCACGAGACAAAGA
AAGAAGCACGACAAGGTAGCCAGGTTTCAATTATGGCCTCAGCTTCCCGCTGTAGCTCCAGCGTACAAGGACCCG
ATGCCCGAGCTGCAGAAGCAACAAATCGCACAACTTGATCCAACTGGCGCAAGAACTCGCCTGTTTTCACGAAAT
GAGCCTGACGCGGCCAAAGTCGGGGACGTGCTTCAAGTCACGAGCAAGCTCGGTGAACCCTTTGCCGGCGTTATG
CTTCAAATACGGCGGCGAGGCGTCAACACGGCCATCCAGCTGCGAGGACAGCTAATGAGGACCAGCATCGAGATG
TGGTACAAGATTTACAGTCCAACCGTCAAGAGCATCGAGATTGTCTGGCGACGGCCGAAGCGGGCGCGGAGAGCA
AGGCTGACATATATGCGCAAGCCCAAGCACGACATGGGCAGCGTCGAGGACCTCGTGCGTTCTTGGAGGCGGCAA
AAATATGCCATGATGTCTGGCGCGAAGCGACAAGATTCTCTCAAAAAGGCCTCCAAGCAGTAG
Gene >OphauG2|3249
ATGAGGGCTCTAATCATGCGACGGCCAATGGGCAGCTTCGGGGCCATGAACCAGCGGGCCAAGAGTCCTGGAATA
CGGCAACAATGCTTTGCAACCGCCACGCACACTCCTGACAAGGCTCCTCCTACATTCTACACCACGAGACAAAGC
AAGGCGCCCAAGCAAGCATATTCCTCAGTCACACGCCAAGGCTGACCCCGCATTAGGAAAGAAGCACGACAAGGT
AGCCAGGTTTCAATTATGGCCTCAGCTTCCCGCTGTAGCTCCAGCGTACAAGGACCCGATGCCCGAGCTGCAGAA
GCAACAAATCGCACAACTTGATCCAACTGGCGCAAGAACTCGCCTGTTTTCACGAAATGAGCCTGACGCGGCCAA
AGTCGGGGACGTGCTTCAAGTCACGAGCAAGCTCGGTGAACCCTTTGCCGGCGTTATGCTTCAAATACGGCGGCG
AGGCGTCAACACGGCCATCCAGCTGCGAGGACAGCTAATGAGGACCAGCATCGAGATGTGGTACAAGATTTACAG
TCCAACCGTCAAGAGCATCGAGATTGTCTGGCGACGGCCGAAGCGGGCGCGGAGAGCAAGGCTGACATATATGCG
CAAGCCCAAGCACGACATGGGCAGCGTCGAGGACCTCGTGCGTTCTTGGAGGCGGCAAAAATATGCCATGATGTC
TGGCGCGAAGCGACAAGATTCTCTCAAAAAGGCCTCCAAGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail