Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3248
Gene name
LocationContig_241:3500..6285
Strand-
Gene length (bp)2785
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00307 CH Calponin homology (CH) domain 1.6E-21 214 318
PF00307 CH Calponin homology (CH) domain 1.6E-22 328 433
PF08726 EFhand_Ca_insen Ca2+ insensitive EF hand 7.1E-27 757 826
PF11971 CAMSAP_CH CAMSAP CH domain 8.8E-07 338 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 210 832 0.0E+00
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 211 565 1.0E-84
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 211 585 7.0E-78
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 211 585 9.0E-78
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 211 585 2.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 210 832 0.0E+00
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 211 565 1.0E-84
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 211 585 7.0E-78
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 211 585 9.0E-78
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 211 585 2.0E-77
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 211 585 2.0E-77
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 211 585 3.0E-77
sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 211 585 6.0E-77
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 211 585 6.0E-77
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 211 585 7.0E-77
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 211 585 8.0E-77
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 211 585 1.0E-76
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 211 585 2.0E-76
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 211 585 4.0E-76
sp|Q0III9|ACTN3_BOVIN Alpha-actinin-3 OS=Bos taurus GN=ACTN3 PE=2 SV=1 211 585 7.0E-76
sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus GN=Actn3 PE=2 SV=1 211 585 3.0E-75
sp|Q3ZC55|ACTN2_BOVIN Alpha-actinin-2 OS=Bos taurus GN=ACTN2 PE=2 SV=1 211 585 4.0E-75
sp|Q9JI91|ACTN2_MOUSE Alpha-actinin-2 OS=Mus musculus GN=Actn2 PE=1 SV=2 211 585 5.0E-75
sp|P35609|ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 211 585 6.0E-75
sp|Q08043|ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 211 585 6.0E-75
sp|P20111|ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus GN=ACTN2 PE=2 SV=1 211 585 1.0E-74
sp|P15508|SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus GN=Sptb PE=1 SV=4 213 580 3.0E-74
sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 214 584 1.0E-73
sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 214 584 2.0E-73
sp|P11277|SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5 213 584 4.0E-73
sp|Q9QWN8|SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus GN=Sptbn2 PE=1 SV=2 213 573 9.0E-72
sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3 213 573 3.0E-71
sp|Q7PKQ5|ACTN_ANOGA Alpha-actinin, sarcomeric OS=Anopheles gambiae GN=Actn PE=3 SV=2 211 570 4.0E-71
sp|P18091|ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster GN=Actn PE=1 SV=2 211 570 8.0E-71
sp|Q9H254|SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2 213 587 2.0E-70
sp|Q00963|SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster GN=beta-Spec PE=1 SV=2 213 569 5.0E-70
sp|Q9NRC6|SPTN5_HUMAN Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens GN=SPTBN5 PE=1 SV=2 208 601 4.0E-59
sp|Q9QXZ0|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2 214 595 1.0E-56
sp|Q03001|DYST_HUMAN Dystonin OS=Homo sapiens GN=DST PE=1 SV=4 214 608 4.0E-56
sp|D3ZHV2|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1 214 595 5.0E-56
sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4 214 595 9.0E-56
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 214 561 1.0E-55
sp|Q91ZU6|DYST_MOUSE Dystonin OS=Mus musculus GN=Dst PE=1 SV=2 214 608 4.0E-55
sp|P30427|PLEC_RAT Plectin OS=Rattus norvegicus GN=Plec PE=1 SV=2 214 561 8.0E-54
sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus GN=Plec PE=1 SV=3 214 561 2.0E-53
sp|P13466|GELA_DICDI Gelation factor OS=Dictyostelium discoideum GN=abpC PE=1 SV=1 209 428 3.0E-48
sp|Q54HG2|CTXA_DICDI Cortexillin-1 OS=Dictyostelium discoideum GN=ctxA PE=1 SV=1 211 436 2.0E-47
sp|Q9JI55|PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus GN=PLEC PE=1 SV=1 243 561 7.0E-46
sp|Q9Y0T4|CTXA_POLPA Cortexillin-1 OS=Polysphondylium pallidum GN=ctxA PE=3 SV=1 211 439 1.0E-44
sp|Q550R2|CTXB_DICDI Cortexillin-2 OS=Dictyostelium discoideum GN=ctxB PE=1 SV=1 209 439 8.0E-44
sp|Q8NF91|SYNE1_HUMAN Nesprin-1 OS=Homo sapiens GN=SYNE1 PE=1 SV=4 214 443 1.0E-41
sp|P11533|DMD_CHICK Dystrophin OS=Gallus gallus GN=DMD PE=2 SV=1 214 446 1.0E-41
sp|Q8WXH0|SYNE2_HUMAN Nesprin-2 OS=Homo sapiens GN=SYNE2 PE=1 SV=3 214 430 5.0E-41
sp|Q9Y0T3|CTXB_POLPA Cortexillin-2 OS=Polysphondylium pallidum GN=ctxB PE=3 SV=1 208 439 2.0E-40
sp|Q6ZWR6|SYNE1_MOUSE Nesprin-1 OS=Mus musculus GN=Syne1 PE=1 SV=2 214 432 2.0E-40
sp|O76329|ACTNB_DICDI Interaptin OS=Dictyostelium discoideum GN=abpD PE=1 SV=1 211 434 2.0E-40
sp|Q6ZWQ0|SYNE2_MOUSE Nesprin-2 OS=Mus musculus GN=Syne2 PE=1 SV=2 199 429 3.0E-39
sp|Q96JQ2|CLMN_HUMAN Calmin OS=Homo sapiens GN=CLMN PE=1 SV=1 214 436 3.0E-39
sp|Q8C5W0|CLMN_MOUSE Calmin OS=Mus musculus GN=Clmn PE=1 SV=2 214 450 5.0E-39
sp|P11532|DMD_HUMAN Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3 214 439 5.0E-38
sp|P11530|DMD_RAT Dystrophin OS=Rattus norvegicus GN=Dmd PE=1 SV=2 214 446 5.0E-38
sp|P46939|UTRO_HUMAN Utrophin OS=Homo sapiens GN=UTRN PE=1 SV=2 214 448 7.0E-38
sp|P11531|DMD_MOUSE Dystrophin OS=Mus musculus GN=Dmd PE=1 SV=3 214 494 9.0E-38
sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1 SV=1 214 439 2.0E-37
sp|O97592|DMD_CANLF Dystrophin OS=Canis lupus familiaris GN=DMD PE=2 SV=1 214 439 3.0E-37
sp|Q8VHX6|FLNC_MOUSE Filamin-C OS=Mus musculus GN=Flnc PE=1 SV=3 181 426 1.0E-34
sp|D3ZHA0|FLNC_RAT Filamin-C OS=Rattus norvegicus GN=Flnc PE=1 SV=1 181 426 3.0E-34
sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H OS=Drosophila melanogaster GN=Dys PE=1 SV=3 214 435 4.0E-34
sp|Q9VEN1|FLNA_DROME Filamin-A OS=Drosophila melanogaster GN=cher PE=1 SV=2 201 428 4.0E-34
sp|Q8BTM8|FLNA_MOUSE Filamin-A OS=Mus musculus GN=Flna PE=1 SV=5 174 426 9.0E-34
sp|Q14315|FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 205 426 1.0E-33
sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 205 426 4.0E-33
sp|P18091|ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster GN=Actn PE=1 SV=2 538 829 3.0E-32
sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 205 426 5.0E-32
sp|Q80X90|FLNB_MOUSE Filamin-B OS=Mus musculus GN=Flnb PE=1 SV=3 205 426 7.0E-32
sp|Q7PKQ5|ACTN_ANOGA Alpha-actinin, sarcomeric OS=Anopheles gambiae GN=Actn PE=3 SV=2 538 829 2.0E-31
sp|Q9JI91|ACTN2_MOUSE Alpha-actinin-2 OS=Mus musculus GN=Actn2 PE=1 SV=2 512 806 2.0E-26
sp|P35609|ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 512 806 2.0E-25
sp|P20111|ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus GN=ACTN2 PE=2 SV=1 512 806 3.0E-25
sp|Q3ZC55|ACTN2_BOVIN Alpha-actinin-2 OS=Bos taurus GN=ACTN2 PE=2 SV=1 512 806 5.0E-25
sp|Q0III9|ACTN3_BOVIN Alpha-actinin-3 OS=Bos taurus GN=ACTN3 PE=2 SV=1 513 829 6.0E-25
sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus GN=Actn3 PE=2 SV=1 513 829 9.0E-25
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 547 826 1.0E-24
sp|Q8N3F8|MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens GN=MICALL1 PE=1 SV=2 327 432 3.0E-24
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 576 809 4.0E-24
sp|E1BBG2|MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus GN=MICALL1 PE=1 SV=2 327 433 5.0E-24
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 551 829 1.0E-23
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 551 829 1.0E-23
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 538 809 1.0E-23
sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 551 829 1.0E-23
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 538 809 2.0E-23
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 551 829 2.0E-23
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 551 829 2.0E-23
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 538 807 2.0E-23
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 538 807 2.0E-23
sp|Q8BGT6|MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus GN=Micall1 PE=1 SV=3 327 433 2.0E-23
sp|D3ZQL6|MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus GN=Micall1 PE=1 SV=1 327 433 2.0E-23
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 576 829 3.0E-23
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 538 807 3.0E-23
sp|Q08043|ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 513 829 3.0E-22
sp|D3ZEN0|MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus GN=Micall2 PE=1 SV=2 327 432 2.0E-21
sp|Q8CJ19|MICA3_MOUSE Protein-methionine sulfoxide oxidase MICAL3 OS=Mus musculus GN=Mical3 PE=1 SV=2 316 432 2.0E-21
sp|Q3TN34|MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus GN=Micall2 PE=1 SV=1 327 432 3.0E-21
sp|Q7RTP6|MICA3_HUMAN Protein-methionine sulfoxide oxidase MICAL3 OS=Homo sapiens GN=MICAL3 PE=1 SV=2 316 432 7.0E-21
sp|F1QH17|MCA3A_DANRE Protein-methionine sulfoxide oxidase mical3a OS=Danio rerio GN=mical3a PE=2 SV=2 333 432 7.0E-21
sp|G3MWR8|MICA3_BOVIN Protein-methionine sulfoxide oxidase MICAL3 OS=Bos taurus GN=MICAL3 PE=3 SV=1 316 432 1.0E-20
sp|Q8IY33|MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens GN=MICALL2 PE=1 SV=1 327 432 5.0E-20
sp|Q2KN93|CYTSA_DANRE Cytospin-A OS=Danio rerio GN=specc1la PE=2 SV=2 324 432 2.0E-19
sp|Q2KNA0|CYTSA_CANLF Cytospin-A OS=Canis lupus familiaris GN=SPECC1L PE=2 SV=1 324 432 8.0E-19
sp|Q2KN96|CYTSA_XENTR Cytospin-A OS=Xenopus tropicalis GN=specc1l PE=2 SV=1 324 432 9.0E-19
sp|O94851|MICA2_HUMAN Protein-methionine sulfoxide oxidase MICAL2 OS=Homo sapiens GN=MICAL2 PE=1 SV=1 333 432 2.0E-18
sp|Q2KN94|CYTSA_TAKRU Cytospin-A OS=Takifugu rubripes GN=specc1l PE=2 SV=1 324 432 2.0E-18
sp|Q2KNA1|CYTSA_PANTR Cytospin-A OS=Pan troglodytes GN=SPECC1L PE=2 SV=1 324 432 2.0E-18
sp|Q69YQ0|CYTSA_HUMAN Cytospin-A OS=Homo sapiens GN=SPECC1L PE=1 SV=2 324 432 2.0E-18
sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 521 827 3.0E-18
sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3 521 827 3.0E-18
sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus GN=Sptan1 PE=1 SV=4 521 827 3.0E-18
sp|P16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus GN=Sptan1 PE=1 SV=2 521 827 3.0E-18
sp|Q8NDI1|EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens GN=EHBP1 PE=1 SV=3 328 436 3.0E-18
sp|P07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus GN=SPTAN1 PE=1 SV=3 521 827 6.0E-18
sp|Q2KN98|CYTSA_MOUSE Cytospin-A OS=Mus musculus GN=Specc1l PE=1 SV=1 324 432 7.0E-18
sp|Q2KN97|CYTSA_CHICK Cytospin-A OS=Gallus gallus GN=SPECC1L PE=2 SV=2 324 432 7.0E-18
sp|F6QZ15|MICA2_XENTR Protein-methionine sulfoxide oxidase mical2 OS=Xenopus tropicalis GN=mical2 PE=3 SV=1 333 432 7.0E-18
sp|Q2KN95|CYTSA_TETNG Cytospin-A OS=Tetraodon nigroviridis GN=specc1l PE=2 SV=1 324 432 8.0E-18
sp|Q69ZW3|EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus GN=Ehbp1 PE=1 SV=3 328 436 1.0E-17
sp|F1MF74|MICA2_BOVIN Protein-methionine sulfoxide oxidase MICAL2 OS=Bos taurus GN=MICAL2 PE=3 SV=2 326 432 1.0E-17
sp|Q9N4M4|ANC1_CAEEL Nuclear anchorage protein 1 OS=Caenorhabditis elegans GN=anc-1 PE=1 SV=3 215 319 1.0E-17
sp|P02549|SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens GN=SPTA1 PE=1 SV=5 535 822 2.0E-17
sp|Q2KN99|CYTSA_RAT Cytospin-A OS=Rattus norvegicus GN=Specc1l PE=1 SV=1 324 432 2.0E-17
sp|D4A1F2|MICA2_RAT Protein-methionine sulfoxide oxidase MICAL2 OS=Rattus norvegicus GN=Mical2 PE=3 SV=1 333 432 3.0E-17
sp|Q8BML1|MICA2_MOUSE Protein-methionine sulfoxide oxidase MICAL2 OS=Mus musculus GN=Mical2 PE=1 SV=1 333 432 4.0E-17
sp|Q2KI85|SMTL2_BOVIN Smoothelin-like protein 2 OS=Bos taurus GN=SMTNL2 PE=2 SV=1 328 436 7.0E-17
sp|F1RA39|MCA2B_DANRE Protein-methionine sulfoxide oxidase mical2b OS=Danio rerio GN=mical2b PE=2 SV=2 333 432 1.0E-16
sp|Q5M775|CYTSB_HUMAN Cytospin-B OS=Homo sapiens GN=SPECC1 PE=1 SV=1 324 432 1.0E-16
sp|Q8CI12|SMTL2_MOUSE Smoothelin-like protein 2 OS=Mus musculus GN=Smtnl2 PE=1 SV=1 328 436 2.0E-16
sp|A8MU46|SMTL1_HUMAN Smoothelin-like protein 1 OS=Homo sapiens GN=SMTNL1 PE=1 SV=1 333 434 4.0E-16
sp|E7F9T0|MICA1_DANRE Protein-methionine sulfoxide oxidase mical1 OS=Danio rerio GN=mical1 PE=3 SV=1 324 434 5.0E-16
sp|Q5SXY1|CYTSB_MOUSE Cytospin-B OS=Mus musculus GN=Specc1 PE=1 SV=2 324 432 9.0E-16
sp|Q2TAL5|SMTL2_HUMAN Smoothelin-like protein 2 OS=Homo sapiens GN=SMTNL2 PE=2 SV=1 328 436 1.0E-15
sp|Q99LM3|SMTL1_MOUSE Smoothelin-like protein 1 OS=Mus musculus GN=Smtnl1 PE=1 SV=1 333 434 5.0E-15
sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus GN=Spta1 PE=1 SV=3 535 822 6.0E-15
sp|F1QWK4|MCA3B_DANRE Protein-methionine sulfoxide oxidase mical3b OS=Danio rerio GN=mical3b PE=3 SV=2 288 426 7.0E-15
sp|Q8N3D4|EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens GN=EHBP1L1 PE=1 SV=2 327 442 1.0E-14
sp|Q921U8|SMTN_MOUSE Smoothelin OS=Mus musculus GN=Smtn PE=1 SV=2 317 436 2.0E-14
sp|Q99MS7|EH1L1_MOUSE EH domain-binding protein 1-like protein 1 OS=Mus musculus GN=Ehbp1l1 PE=1 SV=1 327 453 3.0E-14
sp|P53814|SMTN_HUMAN Smoothelin OS=Homo sapiens GN=SMTN PE=1 SV=7 317 436 7.0E-14
sp|Q75JP5|Y2471_DICDI Calponin homology domain-containing protein DDB_G0272472 OS=Dictyostelium discoideum GN=DDB_G0272472 PE=3 SV=1 326 434 8.0E-14
sp|Q9N4M4|ANC1_CAEEL Nuclear anchorage protein 1 OS=Caenorhabditis elegans GN=anc-1 PE=1 SV=3 348 434 4.0E-13
sp|Q5TZ18|NAV3_DANRE Neuron navigator 3 OS=Danio rerio GN=nav3 PE=3 SV=1 217 313 1.0E-12
sp|Q7G188|FIMB1_ARATH Fimbrin-1 OS=Arabidopsis thaliana GN=FIM1 PE=1 SV=2 216 428 1.0E-12
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 211 319 5.0E-12
sp|Q8IVL0|NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens GN=NAV3 PE=1 SV=3 217 313 5.0E-12
sp|Q80TN7|NAV3_MOUSE Neuron navigator 3 OS=Mus musculus GN=Nav3 PE=1 SV=2 217 313 7.0E-12
sp|Q8IVL1|NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens GN=NAV2 PE=1 SV=3 219 313 2.0E-11
sp|Q8VDP3|MICA1_MOUSE Protein-methionine sulfoxide oxidase MICAL1 OS=Mus musculus GN=Mical1 PE=1 SV=1 326 432 2.0E-11
sp|F1MH07|MICA1_BOVIN Protein-methionine sulfoxide oxidase MICAL1 OS=Bos taurus GN=MICAL1 PE=2 SV=1 327 432 3.0E-11
sp|Q8TDZ2|MICA1_HUMAN Protein-methionine sulfoxide oxidase MICAL1 OS=Homo sapiens GN=MICAL1 PE=1 SV=2 321 435 3.0E-11
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 196 428 2.0E-10
sp|D3ZBP4|MICA1_RAT Protein-methionine sulfoxide oxidase MICAL1 OS=Rattus norvegicus GN=Mical1 PE=1 SV=1 326 432 2.0E-10
sp|O50064|FIMB2_ARATH Fimbrin-2 OS=Arabidopsis thaliana GN=FIM2 PE=2 SV=1 184 428 4.0E-10
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 215 426 5.0E-10
sp|Q155Q3|DIXC1_HUMAN Dixin OS=Homo sapiens GN=DIXDC1 PE=1 SV=2 215 317 6.0E-10
sp|Q9FJ70|FIMB3_ARATH Fimbrin-3 OS=Arabidopsis thaliana GN=FIM3 PE=3 SV=1 182 428 8.0E-10
sp|Q2VUH7|DIXC1_RAT Dixin OS=Rattus norvegicus GN=Dixdc1 PE=2 SV=1 215 317 1.0E-09
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 215 428 3.0E-09
sp|Q8CJ27|ASPM_MOUSE Abnormal spindle-like microcephaly-associated protein homolog OS=Mus musculus GN=Aspm PE=2 SV=2 231 446 4.0E-09
sp|Q9TW65|DMD_CAEEL Dystrophin-1 OS=Caenorhabditis elegans GN=dys-1 PE=1 SV=2 290 439 6.0E-09
sp|A7E3Q8|PLST_BOVIN Plastin-3 OS=Bos taurus GN=PLS3 PE=2 SV=1 213 426 7.0E-09
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 684 797 7.0E-09
sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 213 426 9.0E-09
sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 213 426 1.0E-08
sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 213 426 1.0E-08
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 683 818 5.0E-08
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 213 426 5.0E-08
sp|Q63598|PLST_RAT Plastin-3 OS=Rattus norvegicus GN=Pls3 PE=1 SV=2 213 426 6.0E-08
sp|Q1ZXE2|Y7875_DICDI PH domain-containing protein DDB_G0287875 OS=Dictyostelium discoideum GN=DDB_G0287875 PE=2 SV=1 218 436 8.0E-08
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 684 797 8.0E-08
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 213 426 9.0E-08
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 684 797 9.0E-08
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 204 440 1.0E-07
sp|P19179|PLSI_CHICK Plastin-1 OS=Gallus gallus GN=PLS1 PE=1 SV=1 237 441 1.0E-07
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 684 797 1.0E-07
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 684 797 1.0E-07
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 236 412 2.0E-07
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 684 797 2.0E-07
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 684 797 2.0E-07
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 684 797 2.0E-07
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 684 797 2.0E-07
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 684 797 2.0E-07
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 684 797 2.0E-07
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 684 797 2.0E-07
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 684 797 2.0E-07
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 684 797 2.0E-07
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 684 797 2.0E-07
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 684 797 2.0E-07
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 684 797 2.0E-07
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 684 797 2.0E-07
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 684 797 2.0E-07
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 684 797 2.0E-07
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 684 797 2.0E-07
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 684 797 2.0E-07
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 684 797 2.0E-07
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 684 797 2.0E-07
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 684 797 2.0E-07
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 213 330 3.0E-07
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 684 797 3.0E-07
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 684 797 3.0E-07
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 684 797 3.0E-07
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 674 797 3.0E-07
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 683 797 3.0E-07
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 204 440 4.0E-07
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 684 797 4.0E-07
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 684 797 4.0E-07
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 684 797 4.0E-07
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 684 797 4.0E-07
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 684 797 4.0E-07
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 684 797 4.0E-07
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 236 430 5.0E-07
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 684 797 5.0E-07
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 684 797 5.0E-07
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 684 797 5.0E-07
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 680 797 5.0E-07
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 684 797 6.0E-07
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 684 797 6.0E-07
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 684 797 6.0E-07
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 684 797 6.0E-07
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 684 797 6.0E-07
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 684 797 6.0E-07
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 684 797 6.0E-07
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 684 797 7.0E-07
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 683 818 8.0E-07
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 688 797 9.0E-07
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 684 797 9.0E-07
sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 188 440 1.0E-06
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 187 440 1.0E-06
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 684 797 1.0E-06
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 684 797 1.0E-06
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 682 789 1.0E-06
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 684 797 1.0E-06
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 684 797 1.0E-06
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 684 823 1.0E-06
sp|Q14651|PLSI_HUMAN Plastin-1 OS=Homo sapiens GN=PLS1 PE=1 SV=2 215 426 1.0E-06
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 684 797 1.0E-06
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 684 828 1.0E-06
sp|A7E3Q8|PLST_BOVIN Plastin-3 OS=Bos taurus GN=PLS3 PE=2 SV=1 188 440 2.0E-06
sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 188 440 2.0E-06
sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 188 440 2.0E-06
sp|Q63598|PLST_RAT Plastin-3 OS=Rattus norvegicus GN=Pls3 PE=1 SV=2 188 440 2.0E-06
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 684 797 2.0E-06
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 684 797 2.0E-06
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 684 797 2.0E-06
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 684 797 2.0E-06
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 684 797 2.0E-06
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 684 797 3.0E-06
sp|P62297|ASPM_SHEEP Abnormal spindle-like microcephaly-associated protein homolog (Fragment) OS=Ovis aries GN=ASPM PE=2 SV=1 231 379 3.0E-06
sp|P19179|PLSI_CHICK Plastin-1 OS=Gallus gallus GN=PLS1 PE=1 SV=1 215 426 4.0E-06
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 684 828 4.0E-06
sp|P62285|ASPM_BOVIN Abnormal spindle-like microcephaly-associated protein homolog (Fragment) OS=Bos taurus GN=ASPM PE=2 SV=1 231 379 4.0E-06
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 684 797 4.0E-06
sp|A6H742|PLSI_BOVIN Plastin-1 OS=Bos taurus GN=PLS1 PE=2 SV=1 215 426 5.0E-06
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 683 789 5.0E-06
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 684 797 6.0E-06
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 684 797 6.0E-06
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 682 828 6.0E-06
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 684 797 6.0E-06
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 684 797 8.0E-06
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 683 787 8.0E-06
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 684 818 8.0E-06
sp|A6H742|PLSI_BOVIN Plastin-1 OS=Bos taurus GN=PLS1 PE=2 SV=1 208 440 9.0E-06
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 684 797 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3248
MEEASLAPLQPSNVQCLPANGTWRCSTSDTSDARDTDSGHDPGSAALPQQEGLSCNDVNDGSNNNNNINNNNNNI
NPHNNHKPKPNSASIDRSSRYSSSSIDSCCDSTQSSSKSRSSTLSSCSTLDPLSHSHLDSTSPPTQRNRRDKKLL
HAARQQRSASGRTPGGSQSKKQKSRWFQRTSGSSPADALAAVEPVHDQGLARMTFAEQQRWVTVQQKTFTKWLNN
KLVARELEVKDLVQDLSDGVILIHLLECLSNESLGRYASKPKLRVQRFENANLALDFIKSRGIQMTNIGAEDVVD
GNRKIVLGLIWTLILRFTISDINEEGMSAKEGLLLWCQRKTACYDEVQVRDFSGSWNDGLAFCALLDIHRPDLID
FDALDKSDHRGNMQKAFDIAHREIGIPRLLDVEDVCDVAKPDERSLMTYIAYWFHAFSQMEKVENAGRRVEKFVN
NMQGAWEMQSAYERRMRALLQANREQVDQWQQAKFQGTYADAKAQAQEFAAYKRGQKRAWVAEKSDLATLLGNIK
TKLGTYRLRPYEPPAELRLEVLERDWTTLTQAEMKRAQLINETIRDIKNALRKSFADKANDLAMALNTMQLAISG
LDGDVEDQLHHVRKLSDNLPPLERYLETIAALDVKCQEANIEENDFTTYTYDELWYELGLVKSSVQKKLSFLENQ
MVARNMTNLTPIQLEEFESVFRHFDRDDTNSLQELEFSAALASLGLVFSEEEMHDYFGETSNGRDHVTFEQFIRF
MVEVTEDQNTAEQVFQSFREVADGKPYVTEMDLRHSLVPDEVIDQLVEMMPPHKGPDMSEDRGQPQYDYIGFMEK
LINEEGQADEVPSGVLQDRTNVADEGVRTRGKMNGGGG*
Coding >OphauG2|3248
ATGGAGGAAGCGTCGCTGGCGCCGCTGCAGCCCAGCAACGTACAGTGTTTACCCGCCAACGGTACATGGAGGTGC
TCGACTAGCGATACTAGCGATGCTAGGGATACAGATAGCGGCCATGACCCTGGAAGCGCTGCATTACCACAACAA
GAGGGCCTGAGCTGCAACGACGTCAACGACGGCAGCAACAACAACAACAACATCAACAACAACAACAACAACATC
AACCCCCACAACAACCACAAACCCAAGCCCAACTCGGCTTCGATTGACAGAAGCAGCCGCTACAGCTCCTCGTCC
ATCGACAGCTGCTGCGATTCGACGCAATCATCCTCAAAGTCTCGCTCCTCAACTCTCTCGTCGTGCTCGACCTTG
GACCCTCTCTCGCACTCACACCTAGACAGCACCAGCCCCCCGACGCAGCGAAACAGAAGGGACAAGAAGCTGCTG
CACGCGGCGCGCCAGCAGCGATCAGCCAGCGGCAGGACTCCGGGCGGCTCGCAGAGCAAGAAACAAAAGTCGCGC
TGGTTCCAACGCACCTCGGGTAGCAGTCCGGCCGACGCCCTTGCCGCTGTAGAGCCGGTCCATGATCAGGGGCTC
GCCAGGATGACTTTTGCTGAGCAGCAGCGCTGGGTCACGGTGCAGCAAAAGACATTTACAAAATGGCTTAACAAC
AAGCTGGTGGCTCGCGAGCTGGAGGTCAAGGACCTGGTTCAGGATCTGAGTGATGGCGTTATTCTTATCCACCTC
CTCGAATGTCTCTCCAACGAGTCCCTCGGCCGCTATGCGTCCAAGCCCAAGCTACGAGTACAGCGCTTCGAAAAT
GCAAACCTAGCCCTCGACTTTATCAAGTCTAGGGGCATACAAATGACCAATATTGGAGCCGAGGATGTTGTCGAC
GGGAACCGCAAGATTGTTCTCGGCCTCATCTGGACCTTGATTCTTCGCTTCACCATCAGCGACATCAATGAGGAG
GGCATGTCAGCCAAAGAGGGCCTGCTCCTCTGGTGTCAGCGCAAGACGGCATGCTACGACGAGGTCCAAGTCCGT
GATTTTAGCGGCAGCTGGAACGATGGCCTTGCATTTTGCGCCCTGCTCGATATCCATCGGCCCGACCTCATCGAC
TTTGACGCCCTCGACAAGTCTGACCACCGCGGAAACATGCAAAAGGCCTTTGACATTGCCCACCGAGAGATTGGA
ATCCCCAGGCTGCTCGATGTTGAAGATGTGTGCGACGTGGCCAAGCCCGACGAGCGCAGTCTGATGACTTATATT
GCCTATTGGTTCCATGCCTTTTCGCAAATGGAAAAGGTGGAAAACGCTGGCCGCCGGGTGGAAAAGTTTGTCAAC
AACATGCAGGGTGCCTGGGAGATGCAGAGCGCCTATGAGAGGCGCATGCGTGCCCTGCTCCAGGCGAACAGGGAG
CAGGTTGATCAATGGCAGCAGGCCAAGTTCCAGGGGACGTATGCCGATGCCAAGGCGCAAGCACAAGAGTTTGCC
GCCTACAAAAGAGGGCAAAAGCGCGCCTGGGTGGCCGAGAAGAGCGATCTGGCCACACTGCTGGGCAACATCAAA
ACCAAGCTGGGCACTTACCGCCTTCGCCCATATGAGCCTCCTGCAGAGCTGCGGTTGGAAGTCTTGGAGCGAGAT
TGGACAACTCTGACCCAAGCCGAAATGAAGCGGGCCCAACTAATCAACGAGACTATACGAGACATCAAAAACGCT
CTGCGCAAGTCGTTTGCTGACAAGGCCAATGACCTGGCCATGGCCCTCAACACGATGCAGCTGGCCATTTCAGGG
CTCGATGGAGATGTTGAGGACCAGCTGCACCATGTGCGAAAACTGAGCGACAACCTGCCGCCTCTGGAACGCTAC
CTGGAGACCATTGCCGCACTCGACGTCAAGTGCCAGGAGGCTAATATTGAGGAAAACGACTTCACCACATACACG
TATGACGAGCTTTGGTATGAGCTGGGTCTCGTCAAGTCATCGGTACAGAAGAAGCTTTCCTTCTTGGAGAATCAA
ATGGTGGCTCGCAACATGACAAACTTGACGCCCATTCAGCTGGAAGAATTCGAGAGTGTCTTTCGGCACTTTGAC
CGCGACGACACCAACTCTCTACAGGAACTCGAGTTTAGCGCTGCCTTGGCCTCGTTGGGGCTCGTCTTCTCGGAA
GAGGAAATGCACGACTACTTTGGCGAGACGTCGAATGGCCGCGACCACGTGACGTTTGAGCAGTTTATCCGCTTC
ATGGTGGAGGTGACTGAGGACCAAAACACGGCCGAACAAGTGTTTCAGTCCTTTCGCGAAGTTGCGGACGGCAAG
CCCTACGTCACCGAGATGGACCTGCGGCACAGTCTGGTTCCTGACGAGGTGATTGACCAGTTGGTGGAGATGATG
CCCCCGCACAAGGGGCCCGACATGTCTGAGGACCGTGGCCAGCCACAGTATGACTACATTGGCTTTATGGAGAAG
CTCATTAACGAAGAGGGTCAAGCGGATGAGGTGCCGAGCGGAGTGTTGCAGGACCGGACGAATGTTGCCGATGAG
GGTGTTCGCACCAGAGGCAAGATGAATGGCGGGGGCGGGTAA
Transcript >OphauG2|3248
ATGGAGGAAGCGTCGCTGGCGCCGCTGCAGCCCAGCAACGTACAGTGTTTACCCGCCAACGGTACATGGAGGTGC
TCGACTAGCGATACTAGCGATGCTAGGGATACAGATAGCGGCCATGACCCTGGAAGCGCTGCATTACCACAACAA
GAGGGCCTGAGCTGCAACGACGTCAACGACGGCAGCAACAACAACAACAACATCAACAACAACAACAACAACATC
AACCCCCACAACAACCACAAACCCAAGCCCAACTCGGCTTCGATTGACAGAAGCAGCCGCTACAGCTCCTCGTCC
ATCGACAGCTGCTGCGATTCGACGCAATCATCCTCAAAGTCTCGCTCCTCAACTCTCTCGTCGTGCTCGACCTTG
GACCCTCTCTCGCACTCACACCTAGACAGCACCAGCCCCCCGACGCAGCGAAACAGAAGGGACAAGAAGCTGCTG
CACGCGGCGCGCCAGCAGCGATCAGCCAGCGGCAGGACTCCGGGCGGCTCGCAGAGCAAGAAACAAAAGTCGCGC
TGGTTCCAACGCACCTCGGGTAGCAGTCCGGCCGACGCCCTTGCCGCTGTAGAGCCGGTCCATGATCAGGGGCTC
GCCAGGATGACTTTTGCTGAGCAGCAGCGCTGGGTCACGGTGCAGCAAAAGACATTTACAAAATGGCTTAACAAC
AAGCTGGTGGCTCGCGAGCTGGAGGTCAAGGACCTGGTTCAGGATCTGAGTGATGGCGTTATTCTTATCCACCTC
CTCGAATGTCTCTCCAACGAGTCCCTCGGCCGCTATGCGTCCAAGCCCAAGCTACGAGTACAGCGCTTCGAAAAT
GCAAACCTAGCCCTCGACTTTATCAAGTCTAGGGGCATACAAATGACCAATATTGGAGCCGAGGATGTTGTCGAC
GGGAACCGCAAGATTGTTCTCGGCCTCATCTGGACCTTGATTCTTCGCTTCACCATCAGCGACATCAATGAGGAG
GGCATGTCAGCCAAAGAGGGCCTGCTCCTCTGGTGTCAGCGCAAGACGGCATGCTACGACGAGGTCCAAGTCCGT
GATTTTAGCGGCAGCTGGAACGATGGCCTTGCATTTTGCGCCCTGCTCGATATCCATCGGCCCGACCTCATCGAC
TTTGACGCCCTCGACAAGTCTGACCACCGCGGAAACATGCAAAAGGCCTTTGACATTGCCCACCGAGAGATTGGA
ATCCCCAGGCTGCTCGATGTTGAAGATGTGTGCGACGTGGCCAAGCCCGACGAGCGCAGTCTGATGACTTATATT
GCCTATTGGTTCCATGCCTTTTCGCAAATGGAAAAGGTGGAAAACGCTGGCCGCCGGGTGGAAAAGTTTGTCAAC
AACATGCAGGGTGCCTGGGAGATGCAGAGCGCCTATGAGAGGCGCATGCGTGCCCTGCTCCAGGCGAACAGGGAG
CAGGTTGATCAATGGCAGCAGGCCAAGTTCCAGGGGACGTATGCCGATGCCAAGGCGCAAGCACAAGAGTTTGCC
GCCTACAAAAGAGGGCAAAAGCGCGCCTGGGTGGCCGAGAAGAGCGATCTGGCCACACTGCTGGGCAACATCAAA
ACCAAGCTGGGCACTTACCGCCTTCGCCCATATGAGCCTCCTGCAGAGCTGCGGTTGGAAGTCTTGGAGCGAGAT
TGGACAACTCTGACCCAAGCCGAAATGAAGCGGGCCCAACTAATCAACGAGACTATACGAGACATCAAAAACGCT
CTGCGCAAGTCGTTTGCTGACAAGGCCAATGACCTGGCCATGGCCCTCAACACGATGCAGCTGGCCATTTCAGGG
CTCGATGGAGATGTTGAGGACCAGCTGCACCATGTGCGAAAACTGAGCGACAACCTGCCGCCTCTGGAACGCTAC
CTGGAGACCATTGCCGCACTCGACGTCAAGTGCCAGGAGGCTAATATTGAGGAAAACGACTTCACCACATACACG
TATGACGAGCTTTGGTATGAGCTGGGTCTCGTCAAGTCATCGGTACAGAAGAAGCTTTCCTTCTTGGAGAATCAA
ATGGTGGCTCGCAACATGACAAACTTGACGCCCATTCAGCTGGAAGAATTCGAGAGTGTCTTTCGGCACTTTGAC
CGCGACGACACCAACTCTCTACAGGAACTCGAGTTTAGCGCTGCCTTGGCCTCGTTGGGGCTCGTCTTCTCGGAA
GAGGAAATGCACGACTACTTTGGCGAGACGTCGAATGGCCGCGACCACGTGACGTTTGAGCAGTTTATCCGCTTC
ATGGTGGAGGTGACTGAGGACCAAAACACGGCCGAACAAGTGTTTCAGTCCTTTCGCGAAGTTGCGGACGGCAAG
CCCTACGTCACCGAGATGGACCTGCGGCACAGTCTGGTTCCTGACGAGGTGATTGACCAGTTGGTGGAGATGATG
CCCCCGCACAAGGGGCCCGACATGTCTGAGGACCGTGGCCAGCCACAGTATGACTACATTGGCTTTATGGAGAAG
CTCATTAACGAAGAGGGTCAAGCGGATGAGGTGCCGAGCGGAGTGTTGCAGGACCGGACGAATGTTGCCGATGAG
GGTGTTCGCACCAGAGGCAAGATGAATGGCGGGGGCGGGTAA
Gene >OphauG2|3248
ATGGAGGAAGCGTCGCTGGCGCCGCTGCAGCCCAGCAACGTACAGTGTTTACCCGCCAACGGTACATGGAGGTGC
TCGACTAGCGATACTAGCGATGCTAGGGATACAGATAGCGGCCATGACCCTGGAAGCGCTGCATTACCACAACAA
GAGGGCCTGAGCTGCAACGACGTCAACGACGGCAGCAACAACAACAACAACATCAACAACAACAACAACAACATC
AACCCCCACAACAACCACAAACCCAAGCCCAACTCGGCTTCGATTGACAGAAGCAGCCGCTACAGCTCCTCGTCC
ATCGACAGCTGCTGCGATTCGACGCAATCATCCTCAAAGTCTCGCTCCTCAACTCTCTCGTCGTGCTCGACCTTG
GACCCTCTCTCGCACTCACACCTAGACAGCACCAGCCCCCCGACGCAGCGAAACAGAAGGGACAAGAAGCTGCTG
CACGCGGCGCGCCAGCAGCGATCAGCCAGCGGCAGGACTCCGGGCGGCTCGCAGAGCAAGAAACAAAAGTCGCGC
TGGTTCCAACGCACCTCGGGTAGCAGTCCGGCCGACGCCCTTGCCGCTGTAGAGCCGGTCCATGATCAGGGGCTC
GCCAGGATGACTTTTGCTGAGCAGCAGCGCTGGGTCACGGTGCAGCAAAAGACATTTACAAAATGGTGCGGCTGT
CCGTGCCTATTCCCTTGGCCACTGGCCGCCTCTTTTTCCCTTGCCTACAAGGGACTGGACTGACTTGGCGCAGGC
TTAACAACAAGCTGGTGGCTCGCGAGCTGGAGGTCAAGGACCTGGTTCAGGATCTGAGTGATGGCGTATGTCGCG
CCACTTCTCTCGCCCCCCAAAAGTACTAACACGCCTGACCCATAGGTTATTCTTATCCACCTCCTCGAATGTCTC
TCCAACGAGTCCCTCGGCCGCTATGCGTCCAAGCCCAAGCTACGAGTACAGCGCTTCGAAAATGCAAACCTAGCC
CTCGACTTTATCAAGTCTAGGGGCATACAAATGACCAATATTGGAGCCGAGGATGTTGTCGACGGGAACCGCAAG
ATTGTTCTCGGCCTCATCTGGACCTTGATTCTTCGCTTCACCATCAGCGACATCAATGAGGAGGGCATGTCAGCC
AAAGAGGGCCTGCTCCTCTGGTGTCAGCGCAAGACGGCATGCTACGACGAGGTCCAAGTCCGTGATTTTAGCGGC
AGCTGGAACGATGGCCTTGCATTTTGCGCCCTGCTCGATATCCATCGGCCCGACCTCATCGACTTTGACGCCCTC
GACAAGTCTGACCACCGCGGAAACATGCAAAAGGCCTTTGACATTGCCCACCGAGAGATTGGAATCCCCAGGCTG
CTCGATGTTGAAGATGTGTGCGACGTGGCCAAGCCCGACGAGCGCAGTCTGATGACTTATATTGCCTATTGGTTC
CATGCCTTTTCGCAAATGGAAAAGGTGGAAAACGCTGGCCGCCGGGTGGAAAAGTTTGTCAACAACATGCAGGGT
GCCTGGGAGATGCAGAGCGCCTATGAGAGGCGCATGCGTGCCCTGCTCCAGGCGAACAGGGAGCAGGTTGATCAA
TGGCAGCAGGCCAAGTTCCAGGGGACGTATGCCGATGCCAAGGCGCAAGCACAAGAGTTTGCCGCCTACAAAAGA
GGGCAAAAGCGCGCCTGGGTGGCCGAGAAGAGCGATCTGGCCACACTGCTGGGCAACATCAAAACCAAGCTGGGC
ACTTACCGCCTTCGCCCATATGAGCCTCCTGCAGAGCTGCGGTTGGAAGTCTTGGAGCGAGATTGGACAACTCTG
ACCCAAGCCGAAATGAAGCGGGCCCAACTAATCAACGAGACTATACGAGAGTAGGTGCCTTTCCACTGCTTAAGC
CAAGGGCCAGGGACTGACGACAAGAGACAGCATCAAAAACGCTCTGCGCAAGTCGTTTGCTGACAAGGCCAATGA
CCTGGCCATGGCCCTCAACACGATGCAGCTGGCCATTTCAGGGCTCGATGGAGATGTTGAGGACCAGCTGCACCA
TGTGCGAAAACTGAGCGACAACCTGCCGCCTCTGGAACGCTACCTGGAGACCATTGCCGCACTCGACGTCAAGTG
CCAGGAGGCTAATATTGAGGAAAACGACTTCACCACATACACGTATGACGAGCTTTGGTATGAGCTGGGTCTCGT
CAAGTCATCGGTACAGAAGAAGCTTTCCTTCTTGGAGAATCAAATGGTGGCTCGCAACATGACAAACTTGACGCC
CATTCAGCTGGAAGAATTCGAGAGTGTCTTTCGGCACTTTGACCGCGACGACACCAACTCTCTACAGGAACTCGA
GTTTAGCGCTGCCTTGGCCTCGTTGGGGCTCGTCTTCTCGGAAGAGGAAATGCACGACTACTTTGGCGAGACGTC
GAATGGCCGCGACCACGTGACGTTTGAGCAGTTTATCCGCTTCATGGTGGAGGTGACTGAGGACCAAAACACGGC
CGAACAAGTGTTTCAGTCCTTTCGCGAAGTTGCGGACGGCAAGCCCTACGTCACCGAGATGGACCTGCGGCACAG
TCTGGTTCCTGACGAGGTGATTGACCAGTTGGTGGAGATGATGCCCCCGCACAAGGGGCCCGACATGTCTGAGGA
CCGTGGCCAGCCACAGTATGACTACATTGGCTTTATGGAGAAGCTCATTAACGAAGAGGGTCAAGCGGATGAGGT
GCCGAGCGGAGTGTTGCAGGACCGGACGAATGTTGCCGATGAGGGTGTTCGCACCAGAGGCAAGATGAATGGCGG
GGGCGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail