Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3243
Gene name
LocationContig_240:11207..13398
Strand+
Gene length (bp)2191
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00113 Enolase_C Enolase, C-terminal TIM barrel domain 1.9E-152 218 509
PF03952 Enolase_N Enolase, N-terminal domain 2.4E-56 77 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV85|ENO_NEUCR Enolase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=emp-7 PE=3 SV=1 75 512 0.0E+00
sp|Q6RG04|ENO_CRYPA Enolase OS=Cryphonectria parasitica GN=ENO1 PE=3 SV=1 75 512 0.0E+00
sp|Q12560|ENO_ASPOR Enolase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=enoA PE=2 SV=1 75 512 0.0E+00
sp|Q96X30|ENO_ASPFU Enolase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=enoA PE=1 SV=3 75 512 0.0E+00
sp|Q76KF9|ENO_PENCH Enolase OS=Penicillium chrysogenum GN=enoA PE=2 SV=1 75 512 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV85|ENO_NEUCR Enolase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=emp-7 PE=3 SV=1 75 512 0.0E+00
sp|Q6RG04|ENO_CRYPA Enolase OS=Cryphonectria parasitica GN=ENO1 PE=3 SV=1 75 512 0.0E+00
sp|Q12560|ENO_ASPOR Enolase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=enoA PE=2 SV=1 75 512 0.0E+00
sp|Q96X30|ENO_ASPFU Enolase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=enoA PE=1 SV=3 75 512 0.0E+00
sp|Q76KF9|ENO_PENCH Enolase OS=Penicillium chrysogenum GN=enoA PE=2 SV=1 75 512 0.0E+00
sp|Q9HDT3|ENO_ALTAL Enolase OS=Alternaria alternata GN=ENO PE=1 SV=2 75 512 0.0E+00
sp|Q5B135|ENO_EMENI Enolase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=enoA PE=1 SV=1 75 512 0.0E+00
sp|P42040|ENO_DAVTA Enolase OS=Davidiella tassiana GN=ENO PE=1 SV=2 75 512 0.0E+00
sp|Q96X46|ENO_PENCI Enolase OS=Penicillium citrinum GN=enoA PE=1 SV=3 75 512 0.0E+00
sp|Q6W3C0|ENO_TUBBO Enolase OS=Tuber borchii GN=eno-1 PE=1 SV=1 77 503 0.0E+00
sp|Q96VP4|ENO_COCLU Enolase OS=Cochliobolus lunatus PE=2 SV=1 75 512 0.0E+00
sp|Q6C1F3|ENO_YARLI Enolase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ENO PE=3 SV=1 75 507 0.0E+00
sp|Q870B9|ENO_RHOMI Enolase OS=Rhodotorula mucilaginosa GN=ENO PE=1 SV=1 75 512 0.0E+00
sp|Q6BI20|ENO2_DEBHA Enolase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ENO2 PE=3 SV=1 75 512 0.0E+00
sp|P30575|ENO1_CANAL Enolase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ENO1 PE=2 SV=1 78 512 0.0E+00
sp|Q6FQY4|ENO2_CANGA Enolase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ENO2 PE=3 SV=1 75 512 0.0E+00
sp|P00924|ENO1_YEAST Enolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENO1 PE=1 SV=3 75 507 0.0E+00
sp|Q756H2|ENO_ASHGO Enolase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ENO PE=3 SV=1 75 512 0.0E+00
sp|Q70CP7|ENO_KLULA Enolase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ENO PE=3 SV=1 75 512 0.0E+00
sp|Q6BTB1|ENO1_DEBHA Enolase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ENO1 PE=3 SV=1 75 512 0.0E+00
sp|P42894|ENO_NEOFR Enolase OS=Neocallimastix frontalis PE=3 SV=1 75 508 0.0E+00
sp|P00925|ENO2_YEAST Enolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENO2 PE=1 SV=2 75 507 0.0E+00
sp|O74286|ENO_CUNEL Enolase (Fragment) OS=Cunninghamella elegans PE=2 SV=1 77 512 0.0E+00
sp|P40370|ENO11_SCHPO Enolase 1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eno101 PE=1 SV=2 75 510 0.0E+00
sp|Q27527|ENO_CAEEL Enolase OS=Caenorhabditis elegans GN=enol-1 PE=1 SV=3 75 507 0.0E+00
sp|P0CX11|ERR2_YEAST Enolase-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERR2 PE=3 SV=1 75 507 0.0E+00
sp|P0CX10|ERR1_YEAST Enolase-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERR1 PE=3 SV=1 75 507 0.0E+00
sp|P42222|ERR3_YEAST Enolase-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERR3 PE=3 SV=2 75 507 0.0E+00
sp|O02654|ENO_DORPE Enolase OS=Doryteuthis pealeii PE=2 SV=1 75 507 0.0E+00
sp|Q27655|ENO_FASHE Enolase OS=Fasciola hepatica GN=ENO PE=2 SV=1 75 508 0.0E+00
sp|Q9PVK2|ENOA_ALLMI Alpha-enolase OS=Alligator mississippiensis PE=2 SV=3 75 507 0.0E+00
sp|Q6FTW6|ENO1_CANGA Enolase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ENO1 PE=3 SV=1 75 508 0.0E+00
sp|O57391|ENOG_CHICK Gamma-enolase OS=Gallus gallus GN=ENO2 PE=2 SV=1 75 507 0.0E+00
sp|Q9W7L2|ENOA_SCEUN Alpha-enolase OS=Sceloporus undulatus PE=2 SV=3 75 507 0.0E+00
sp|P51913|ENOA_CHICK Alpha-enolase OS=Gallus gallus GN=ENO1 PE=2 SV=2 75 507 0.0E+00
sp|P17183|ENOG_MOUSE Gamma-enolase OS=Mus musculus GN=Eno2 PE=1 SV=2 75 507 0.0E+00
sp|P09104|ENOG_HUMAN Gamma-enolase OS=Homo sapiens GN=ENO2 PE=1 SV=3 75 507 0.0E+00
sp|P19140|ENOA_ANAPL Alpha-enolase OS=Anas platyrhynchos GN=ENO1 PE=2 SV=2 75 507 0.0E+00
sp|Q9XSJ4|ENOA_BOVIN Alpha-enolase OS=Bos taurus GN=ENO1 PE=1 SV=4 75 507 0.0E+00
sp|Q9W7L1|ENOA_TRASC Alpha-enolase OS=Trachemys scripta PE=2 SV=3 75 507 0.0E+00
sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens GN=ENO1 PE=1 SV=2 75 507 0.0E+00
sp|P13929|ENOB_HUMAN Beta-enolase OS=Homo sapiens GN=ENO3 PE=1 SV=5 75 507 0.0E+00
sp|P07323|ENOG_RAT Gamma-enolase OS=Rattus norvegicus GN=Eno2 PE=1 SV=2 75 507 0.0E+00
sp|Q4R5L2|ENOA_MACFA Alpha-enolase OS=Macaca fascicularis GN=ENO1 PE=2 SV=1 75 507 0.0E+00
sp|P04764|ENOA_RAT Alpha-enolase OS=Rattus norvegicus GN=Eno1 PE=1 SV=4 75 507 0.0E+00
sp|P08734|ENOA_XENLA Alpha-enolase OS=Xenopus laevis GN=eno1 PE=2 SV=2 75 510 0.0E+00
sp|Q5R6Y1|ENOA_PONAB Alpha-enolase OS=Pongo abelii GN=ENO1 PE=2 SV=1 75 507 0.0E+00
sp|P15429|ENOB_RAT Beta-enolase OS=Rattus norvegicus GN=Eno3 PE=1 SV=3 75 507 0.0E+00
sp|P25704|ENOB_RABIT Beta-enolase OS=Oryctolagus cuniculus GN=ENO3 PE=1 SV=4 75 507 0.0E+00
sp|Q3ZC09|ENOB_BOVIN Beta-enolase OS=Bos taurus GN=ENO3 PE=2 SV=1 75 507 0.0E+00
sp|P17182|ENOA_MOUSE Alpha-enolase OS=Mus musculus GN=Eno1 PE=1 SV=3 75 507 0.0E+00
sp|B5DGQ7|ENOB_SALSA Beta-enolase OS=Salmo salar GN=ENO3 PE=1 SV=1 75 507 0.0E+00
sp|P21550|ENOB_MOUSE Beta-enolase OS=Mus musculus GN=Eno3 PE=1 SV=3 75 507 0.0E+00
sp|Q1KYT0|ENOB_PIG Beta-enolase OS=Sus scrofa GN=ENO3 PE=2 SV=1 75 507 0.0E+00
sp|I0J1J1|ENOA_THUAL Alpha-enolase OS=Thunnus albacares GN=ENO1 PE=1 SV=1 75 510 0.0E+00
sp|P33676|ENO_SCHJA Enolase OS=Schistosoma japonicum GN=ENO PE=2 SV=1 75 507 0.0E+00
sp|Q9W7L0|ENOA_PYTRG Alpha-enolase OS=Python regius PE=2 SV=3 75 507 0.0E+00
sp|P56252|ENO_HOMGA Enolase OS=Homarus gammarus PE=1 SV=1 76 507 0.0E+00
sp|P15007|ENO_DROME Enolase OS=Drosophila melanogaster GN=Eno PE=1 SV=2 46 508 0.0E+00
sp|Q27877|ENO_SCHMA Enolase OS=Schistosoma mansoni GN=ENO PE=2 SV=1 75 507 0.0E+00
sp|Q8IJN7|ENO_PLAF7 Enolase OS=Plasmodium falciparum (isolate 3D7) GN=ENO PE=3 SV=1 77 511 0.0E+00
sp|Q27727|ENO_PLAFA Enolase OS=Plasmodium falciparum GN=ENO PE=3 SV=1 77 511 0.0E+00
sp|P07322|ENOB_CHICK Beta-enolase OS=Gallus gallus GN=ENO3 PE=1 SV=3 75 507 0.0E+00
sp|Q8NKC2|ENO12_SCHPO Enolase 1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eno102 PE=3 SV=2 74 503 0.0E+00
sp|Q9UAL5|ENO_PLAFG Enolase OS=Plasmodium falciparum (isolate FCR-3 / Gambia) GN=ENO PE=2 SV=1 77 511 0.0E+00
sp|Q9C9C4|ENO1_ARATH Enolase 1, chloroplastic OS=Arabidopsis thaliana GN=ENO1 PE=1 SV=1 77 507 0.0E+00
sp|Q967Y8|ENO_EIMTE Enolase OS=Eimeria tenella GN=ENO PE=2 SV=1 74 511 3.0E-180
sp|P26300|ENO_SOLLC Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1 77 510 1.0E-179
sp|Q43130|ENO_MESCR Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1 74 510 3.0E-179
sp|P51555|ENO1_ENTHI Enolase 1 OS=Entamoeba histolytica GN=ENL-1 PE=1 SV=1 75 509 4.0E-179
sp|Q7RA60|ENO_PLAYO Enolase OS=Plasmodium yoelii yoelii GN=ENO PE=3 SV=2 75 511 1.0E-178
sp|P42895|ENO2_MAIZE Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1 77 510 1.0E-177
sp|Q42971|ENO_ORYSJ Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2 77 510 1.0E-177
sp|P42897|ENO_ALLMI Enolase (Fragment) OS=Alligator mississippiensis PE=2 SV=1 97 495 2.0E-177
sp|P42896|ENO_RICCO Enolase OS=Ricinus communis PE=2 SV=1 75 510 2.0E-177
sp|Q9BPL7|ENO2_TOXGO Enolase 2 OS=Toxoplasma gondii GN=ENO2 PE=1 SV=1 74 507 2.0E-177
sp|Q9LEJ0|ENO1_HEVBR Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1 75 510 2.0E-177
sp|P25696|ENO2_ARATH Bifunctional enolase 2/transcriptional activator OS=Arabidopsis thaliana GN=ENO2 PE=1 SV=1 77 510 3.0E-177
sp|Q9LEI9|ENO2_HEVBR Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1 75 510 3.0E-175
sp|P26301|ENO1_MAIZE Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1 75 510 2.0E-174
sp|Q54RK5|ENOA_DICDI Enolase A OS=Dictyostelium discoideum GN=enoA PE=3 SV=1 77 508 3.0E-174
sp|Q9U615|ENO_MASBA Enolase OS=Mastigamoeba balamuthi GN=ENOL PE=2 SV=1 77 502 1.0E-173
sp|Q9UAE6|ENO1_TOXGO Enolase 1 OS=Toxoplasma gondii GN=ENO1 PE=1 SV=1 74 507 5.0E-168
sp|Q43321|ENO_ALNGL Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1 77 510 5.0E-167
sp|P31683|ENO_CHLRE Enolase (Fragment) OS=Chlamydomonas reinhardtii GN=ENO PE=2 SV=1 136 507 2.0E-161
sp|Q55F83|ENOB_DICDI Enolase B OS=Dictyostelium discoideum GN=enoB PE=3 SV=1 75 506 5.0E-158
sp|Q9ZW34|ENO3_ARATH Cytosolic enolase 3 OS=Arabidopsis thaliana GN=ENO3 PE=1 SV=1 68 507 2.0E-151
sp|O59605|ENO_PYRHO Enolase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eno PE=3 SV=1 77 508 5.0E-151
sp|Q8U477|ENO_PYRFU Enolase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eno PE=3 SV=1 77 508 9.0E-151
sp|Q60173|ENO_METJA Enolase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eno PE=1 SV=2 77 507 3.0E-148
sp|Q5JEV6|ENO_THEKO Enolase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eno PE=3 SV=1 77 507 2.0E-145
sp|B6YUB8|ENO_THEON Enolase OS=Thermococcus onnurineus (strain NA1) GN=eno PE=3 SV=1 77 507 2.0E-144
sp|A6UUM2|ENO_META3 Enolase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eno PE=3 SV=2 77 507 2.0E-144
sp|C5A2S7|ENO_THEGJ Enolase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=eno PE=3 SV=1 77 507 4.0E-144
sp|C5D7M1|ENO_GEOSW Enolase OS=Geobacillus sp. (strain WCH70) GN=eno PE=3 SV=1 76 503 2.0E-142
sp|B3QQT2|ENO_CHLP8 Enolase OS=Chlorobaculum parvum (strain NCIB 8327) GN=eno PE=3 SV=1 77 503 5.0E-142
sp|A6US08|ENO_METVS Enolase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=eno PE=3 SV=2 77 507 5.0E-142
sp|Q3ATQ5|ENO_CHLCH Enolase OS=Chlorobium chlorochromatii (strain CaD3) GN=eno PE=3 SV=1 77 503 5.0E-142
sp|Q5KVE7|ENO_GEOKA Enolase OS=Geobacillus kaustophilus (strain HTA426) GN=eno PE=3 SV=1 76 512 7.0E-142
sp|A4ISP4|ENO_GEOTN Enolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=eno PE=3 SV=1 76 512 7.0E-142
sp|Q1B439|ENO_MYCSS Enolase OS=Mycobacterium sp. (strain MCS) GN=eno PE=3 SV=1 77 506 7.0E-142
sp|A1UL09|ENO_MYCSK Enolase OS=Mycobacterium sp. (strain KMS) GN=eno PE=3 SV=1 77 506 7.0E-142
sp|A3Q5F7|ENO_MYCSJ Enolase OS=Mycobacterium sp. (strain JLS) GN=eno PE=3 SV=1 77 506 7.0E-142
sp|Q9UXZ0|ENO_PYRAB Enolase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eno PE=3 SV=2 77 508 9.0E-142
sp|Q8PT81|ENO_METMA Enolase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eno PE=3 SV=1 77 501 2.0E-141
sp|Q8KG25|ENO2_CHLTE Enolase 2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=eno2 PE=3 SV=1 77 503 2.0E-141
sp|B7IFN4|ENO_THEAB Enolase OS=Thermosipho africanus (strain TCF52B) GN=eno PE=3 SV=1 75 503 3.0E-141
sp|Q468E2|ENO_METBF Enolase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=eno PE=3 SV=1 77 501 5.0E-141
sp|B4S487|ENO_PROA2 Enolase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=eno PE=3 SV=1 77 503 5.0E-141
sp|Q8TQ79|ENO_METAC Enolase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eno PE=3 SV=1 77 501 6.0E-141
sp|Q631M2|ENO_BACCZ Enolase OS=Bacillus cereus (strain ZK / E33L) GN=eno PE=3 SV=1 77 503 8.0E-141
sp|Q6HBF3|ENO_BACHK Enolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=eno PE=3 SV=1 77 503 1.0E-140
sp|C1EZA0|ENO_BACC3 Enolase OS=Bacillus cereus (strain 03BB102) GN=eno PE=3 SV=1 77 503 1.0E-140
sp|B7JFG3|ENO_BACC0 Enolase OS=Bacillus cereus (strain AH820) GN=eno PE=3 SV=1 77 503 1.0E-140
sp|Q81X78|ENO_BACAN Enolase OS=Bacillus anthracis GN=eno PE=3 SV=1 77 503 1.0E-140
sp|A0RKS3|ENO_BACAH Enolase OS=Bacillus thuringiensis (strain Al Hakam) GN=eno PE=3 SV=1 77 503 1.0E-140
sp|C3LDI0|ENO_BACAC Enolase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=eno PE=3 SV=1 77 503 1.0E-140
sp|C3P0A3|ENO_BACAA Enolase OS=Bacillus anthracis (strain A0248) GN=eno PE=3 SV=1 77 503 1.0E-140
sp|A9VQ48|ENO_BACWK Enolase OS=Bacillus weihenstephanensis (strain KBAB4) GN=eno PE=3 SV=1 77 503 2.0E-140
sp|Q67SV9|ENO_SYMTH Enolase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=eno PE=3 SV=1 77 503 2.0E-140
sp|A1R485|ENO_ARTAT Enolase OS=Arthrobacter aurescens (strain TC1) GN=eno PE=3 SV=1 77 507 3.0E-140
sp|Q97L52|ENO_CLOAB Enolase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=eno PE=3 SV=1 77 505 4.0E-140
sp|A4F804|ENO_SACEN Enolase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eno PE=3 SV=1 77 506 1.0E-139
sp|A4SGL6|ENO_CHLPM Enolase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=eno PE=3 SV=1 77 507 2.0E-139
sp|C5C093|ENO_BEUC1 Enolase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=eno PE=3 SV=1 75 503 3.0E-139
sp|A7GUR7|ENO_BACCN Enolase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=eno PE=3 SV=1 77 503 3.0E-139
sp|A7NFI9|ENO_ROSCS Enolase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=eno PE=3 SV=1 77 509 3.0E-139
sp|A5N2N5|ENO_CLOK5 Enolase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=eno PE=3 SV=1 77 505 5.0E-139
sp|B9E6B1|ENO_CLOK1 Enolase OS=Clostridium kluyveri (strain NBRC 12016) GN=eno PE=3 SV=1 77 505 5.0E-139
sp|B3QXY4|ENO_CHLT3 Enolase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=eno PE=3 SV=1 77 507 9.0E-139
sp|A6LR09|ENO_CLOB8 Enolase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=eno PE=3 SV=1 75 509 1.0E-138
sp|E6ER18|ENO_ENTFT Enolase OS=Enterococcus faecalis (strain TX4000 / JH2-2) GN=eno PE=1 SV=1 77 503 1.0E-138
sp|P0DM31|ENO_ENTFA Enolase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=eno PE=3 SV=1 77 503 1.0E-138
sp|Q6NI61|ENO_CORDI Enolase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=eno PE=3 SV=1 77 507 1.0E-138
sp|Q8KNX9|ENO_BACFR Enolase OS=Bacteroides fragilis (strain YCH46) GN=eno PE=3 SV=1 75 502 1.0E-138
sp|Q5LG64|ENO_BACFN Enolase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=eno PE=3 SV=1 75 502 1.0E-138
sp|Q4JU51|ENO_CORJK Enolase OS=Corynebacterium jeikeium (strain K411) GN=eno PE=3 SV=1 77 508 2.0E-138
sp|Q15QR6|ENO_PSEA6 Enolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=eno PE=3 SV=1 77 503 2.0E-138
sp|A6LJF0|ENO_THEM4 Enolase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=eno PE=3 SV=1 75 503 3.0E-138
sp|Q1J2H6|ENO_DEIGD Enolase OS=Deinococcus geothermalis (strain DSM 11300) GN=eno PE=3 SV=1 75 503 4.0E-138
sp|A0R3B8|ENO_MYCS2 Enolase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=eno PE=1 SV=1 77 503 5.0E-138
sp|Q8GR70|ENO_ENTHR Enolase OS=Enterococcus hirae GN=eno PE=1 SV=1 77 503 5.0E-138
sp|Q6ADR6|ENO_LEIXX Enolase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=eno PE=3 SV=1 74 503 6.0E-138
sp|A5V1W0|ENO_ROSS1 Enolase OS=Roseiflexus sp. (strain RS-1) GN=eno PE=3 SV=1 77 503 6.0E-138
sp|Q3AFC8|ENO_CARHZ Enolase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=eno PE=3 SV=1 77 503 7.0E-138
sp|B4SGB2|ENO_PELPB Enolase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=eno PE=3 SV=1 77 512 7.0E-138
sp|B1MKG1|ENO_MYCA9 Enolase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=eno PE=3 SV=1 77 506 7.0E-138
sp|Q89Z05|ENO_BACTN Enolase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=eno PE=3 SV=1 75 502 8.0E-138
sp|Q11QE1|ENO_CYTH3 Enolase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=eno PE=3 SV=1 77 508 8.0E-138
sp|P33675|ENO_ZYMMO Enolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=eno PE=1 SV=2 74 509 8.0E-138
sp|Q12VE5|ENO_METBU Enolase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=eno PE=3 SV=1 77 501 9.0E-138
sp|C3PFA7|ENO_CORA7 Enolase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=eno PE=3 SV=1 77 507 9.0E-138
sp|A6L3M9|ENO_BACV8 Enolase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=eno PE=3 SV=1 75 502 9.0E-138
sp|B8HEU5|ENO_ARTCA Enolase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=eno PE=3 SV=1 77 507 1.0E-137
sp|Q5YQ30|ENO_NOCFA Enolase OS=Nocardia farcinica (strain IFM 10152) GN=eno PE=3 SV=1 77 506 2.0E-137
sp|Q8TUV6|ENO_METKA Enolase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eno PE=3 SV=1 77 504 2.0E-137
sp|Q3B1G7|ENO_CHLL7 Enolase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=eno PE=3 SV=1 77 507 2.0E-137
sp|B0K882|ENO_THEP3 Enolase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=eno PE=3 SV=1 76 505 3.0E-137
sp|A6TU30|ENO_ALKMQ Enolase OS=Alkaliphilus metalliredigens (strain QYMF) GN=eno PE=3 SV=1 77 503 4.0E-137
sp|A0PYP4|ENO_CLONN Enolase OS=Clostridium novyi (strain NT) GN=eno PE=3 SV=1 77 508 8.0E-137
sp|Q03AK4|ENO_LACC3 Enolase OS=Lactobacillus casei (strain ATCC 334) GN=eno PE=3 SV=1 77 503 8.0E-137
sp|A7FQP0|ENO_CLOB1 Enolase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=eno PE=3 SV=1 77 503 9.0E-137
sp|B3EEQ2|ENO_CHLL2 Enolase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=eno PE=3 SV=1 77 507 1.0E-136
sp|Q8NRS1|ENO_CORGL Enolase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=eno PE=3 SV=1 77 507 2.0E-136
sp|A4QCV0|ENO_CORGB Enolase OS=Corynebacterium glutamicum (strain R) GN=eno PE=3 SV=1 77 507 2.0E-136
sp|C1FQW6|ENO_CLOBJ Enolase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=eno PE=3 SV=1 77 503 2.0E-136
sp|A0M568|ENO_GRAFK Enolase OS=Gramella forsetii (strain KT0803) GN=eno PE=3 SV=1 76 501 3.0E-136
sp|A7G9Y3|ENO_CLOBL Enolase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=eno PE=3 SV=1 77 503 3.0E-136
sp|B1IDB9|ENO_CLOBK Enolase OS=Clostridium botulinum (strain Okra / Type B1) GN=eno PE=3 SV=1 77 503 3.0E-136
sp|A0JU21|ENO_ARTS2 Enolase OS=Arthrobacter sp. (strain FB24) GN=eno PE=3 SV=1 77 507 3.0E-136
sp|A0L7X8|ENO_MAGMM Enolase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=eno PE=3 SV=1 76 503 3.0E-136
sp|O66778|ENO_AQUAE Enolase OS=Aquifex aeolicus (strain VF5) GN=eno PE=3 SV=1 77 503 3.0E-136
sp|C0Z6L3|ENO_BREBN Enolase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=eno PE=3 SV=1 77 503 4.0E-136
sp|Q31G68|ENO_THICR Enolase OS=Thiomicrospira crunogena (strain XCL-2) GN=eno PE=3 SV=1 77 505 4.0E-136
sp|B8GAX5|ENO_CHLAD Enolase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=eno PE=3 SV=1 77 505 5.0E-136
sp|Q898R0|ENO_CLOTE Enolase OS=Clostridium tetani (strain Massachusetts / E88) GN=eno PE=3 SV=1 75 503 5.0E-136
sp|B1KTJ8|ENO_CLOBM Enolase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=eno PE=3 SV=1 77 503 7.0E-136
sp|Q0APT2|ENO_MARMM Enolase OS=Maricaulis maris (strain MCS10) GN=eno PE=3 SV=2 74 505 7.0E-136
sp|B3WCW7|ENO_LACCB Enolase OS=Lactobacillus casei (strain BL23) GN=eno PE=3 SV=1 77 503 7.0E-136
sp|Q0B080|ENO_SYNWW Enolase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=eno PE=3 SV=1 77 503 7.0E-136
sp|B0K6X6|ENO_THEPX Enolase OS=Thermoanaerobacter sp. (strain X514) GN=eno PE=3 SV=1 76 505 8.0E-136
sp|A7HNS8|ENO_FERNB Enolase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=eno PE=3 SV=1 77 503 1.0E-135
sp|B0SRL5|ENO_LEPBP Enolase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=eno PE=3 SV=1 76 505 2.0E-135
sp|B0S8S8|ENO_LEPBA Enolase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=eno PE=3 SV=1 76 505 2.0E-135
sp|A9WCM4|ENO_CHLAA Enolase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=eno PE=1 SV=1 77 503 2.0E-135
sp|Q9F2Q3|ENO1_STRCO Enolase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=eno1 PE=3 SV=1 76 507 2.0E-135
sp|Q5R143|ENO_IDILO Enolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=eno PE=3 SV=1 77 511 2.0E-135
sp|Q042F4|ENO2_LACGA Enolase 2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=eno2 PE=1 SV=1 77 503 2.0E-135
sp|Q7V377|ENO_PROMP Enolase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=eno PE=3 SV=1 72 503 3.0E-135
sp|Q31CX3|ENO_PROM9 Enolase OS=Prochlorococcus marinus (strain MIT 9312) GN=eno PE=3 SV=1 72 503 3.0E-135
sp|P37869|ENO_BACSU Enolase OS=Bacillus subtilis (strain 168) GN=eno PE=1 SV=4 77 505 3.0E-135
sp|A5IIQ6|ENO_THEP1 Enolase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=eno PE=3 SV=1 77 503 3.0E-135
sp|P42848|ENO_THEMA Enolase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=eno PE=1 SV=2 77 503 3.0E-135
sp|Q03GW5|ENO_PEDPA Enolase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=eno PE=3 SV=1 77 505 4.0E-135
sp|Q2RT60|ENO_RHORT Enolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=eno PE=3 SV=1 77 508 4.0E-135
sp|Q03SL5|ENO_LACBA Enolase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=eno PE=3 SV=1 77 503 4.0E-135
sp|Q8R967|ENO_CALS4 Enolase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=eno PE=3 SV=1 76 505 5.0E-135
sp|B2GM13|ENO_KOCRD Enolase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=eno PE=3 SV=1 77 506 5.0E-135
sp|Q73P50|ENO_TREDE Enolase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=eno PE=3 SV=1 77 503 6.0E-135
sp|B9KA91|ENO_THENN Enolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=eno PE=3 SV=1 77 503 6.0E-135
sp|Q82HH5|ENO_STRAW Enolase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=eno PE=3 SV=1 76 509 7.0E-135
sp|A5FN12|ENO_FLAJ1 Enolase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=eno PE=3 SV=1 77 508 8.0E-135
sp|B1LCF4|ENO_THESQ Enolase OS=Thermotoga sp. (strain RQ2) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|A2BP03|ENO_PROMS Enolase OS=Prochlorococcus marinus (strain AS9601) GN=eno PE=3 SV=1 72 503 1.0E-134
sp|B9J4M4|ENO_BACCQ Enolase OS=Bacillus cereus (strain Q1) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|B7HW52|ENO_BACC7 Enolase OS=Bacillus cereus (strain AH187) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|Q72XY5|ENO_BACC1 Enolase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|C4L5H4|ENO_EXISA Enolase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|B8DDA1|ENO_LISMH Enolase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|Q71WX1|ENO_LISMF Enolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|C1KY94|ENO_LISMC Enolase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|A0ALD9|ENO_LISW6 Enolase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|P64074|ENO_LISMO Enolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=eno PE=1 SV=1 77 503 1.0E-134
sp|P64075|ENO_LISIN Enolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=eno PE=3 SV=1 77 503 1.0E-134
sp|Q38Y18|ENO_LACSS Enolase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=eno PE=3 SV=1 77 505 1.0E-134
sp|A6W6X2|ENO_KINRD Enolase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=eno PE=3 SV=1 77 503 2.0E-134
sp|A8FHJ0|ENO_BACP2 Enolase OS=Bacillus pumilus (strain SAFR-032) GN=eno PE=3 SV=1 77 503 2.0E-134
sp|C1F9E6|ENO_ACIC5 Enolase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=eno PE=3 SV=1 77 512 2.0E-134
sp|Q47SV1|ENO_THEFY Enolase OS=Thermobifida fusca (strain YX) GN=eno PE=3 SV=1 74 505 2.0E-134
sp|Q6AAB8|ENO_PROAC Enolase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=eno PE=3 SV=1 77 507 2.0E-134
sp|Q6M075|ENO_METMP Enolase OS=Methanococcus maripaludis (strain S2 / LL) GN=eno PE=3 SV=2 77 507 2.0E-134
sp|A7Z8Y1|ENO_BACMF Enolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=eno PE=3 SV=1 77 505 2.0E-134
sp|Q74K78|ENO1_LACJO Enolase 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=eno1 PE=3 SV=1 77 503 3.0E-134
sp|Q65EN2|ENO_BACLD Enolase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=eno PE=3 SV=1 77 503 4.0E-134
sp|B9MEQ4|ENO_ACIET Enolase OS=Acidovorax ebreus (strain TPSY) GN=eno PE=3 SV=1 76 503 4.0E-134
sp|Q24MW5|ENO2_DESHY Enolase 2 OS=Desulfitobacterium hafniense (strain Y51) GN=eno2 PE=3 SV=1 77 503 5.0E-134
sp|A4FZA6|ENO_METM5 Enolase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eno PE=3 SV=2 77 507 5.0E-134
sp|A6GZ69|ENO_FLAPJ Enolase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=eno PE=3 SV=1 77 508 5.0E-134
sp|C4K4K1|ENO_HAMD5 Enolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=eno PE=3 SV=1 77 503 6.0E-134
sp|Q815K8|ENO_BACCR Enolase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=eno PE=3 SV=1 77 503 6.0E-134
sp|B7HED2|ENO_BACC4 Enolase OS=Bacillus cereus (strain B4264) GN=eno PE=3 SV=1 77 503 6.0E-134
sp|B7IP20|ENO_BACC2 Enolase OS=Bacillus cereus (strain G9842) GN=eno PE=3 SV=1 77 503 6.0E-134
sp|Q181T5|ENO_PEPD6 Enolase OS=Peptoclostridium difficile (strain 630) GN=eno PE=3 SV=1 77 503 7.0E-134
sp|A1BD13|ENO_CHLPD Enolase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=eno PE=3 SV=1 77 501 7.0E-134
sp|C1A306|ENO_RHOE4 Enolase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=eno PE=3 SV=1 74 506 7.0E-134
sp|Q2RLT8|ENO_MOOTA Enolase OS=Moorella thermoacetica (strain ATCC 39073) GN=eno PE=3 SV=1 74 503 1.0E-133
sp|A6VUU9|ENO_MARMS Enolase OS=Marinomonas sp. (strain MWYL1) GN=eno PE=3 SV=1 77 503 1.0E-133
sp|A4XKV0|ENO_CALS8 Enolase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=eno PE=3 SV=1 75 505 2.0E-133
sp|A8G2L5|ENO_PROM2 Enolase OS=Prochlorococcus marinus (strain MIT 9215) GN=eno PE=3 SV=1 72 503 2.0E-133
sp|Q88YH3|ENO1_LACPL Enolase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=eno1 PE=3 SV=1 77 503 2.0E-133
sp|A3PAS6|ENO_PROM0 Enolase OS=Prochlorococcus marinus (strain MIT 9301) GN=eno PE=3 SV=1 77 503 2.0E-133
sp|A7HCC4|ENO_ANADF Enolase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=eno PE=3 SV=1 77 510 2.0E-133
sp|Q2NAQ1|ENO_ERYLH Enolase OS=Erythrobacter litoralis (strain HTCC2594) GN=eno PE=3 SV=1 74 503 2.0E-133
sp|A0B7E8|ENO_METTP Enolase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=eno PE=3 SV=1 75 503 2.0E-133
sp|Q2J619|ENO_FRASC Enolase OS=Frankia sp. (strain CcI3) GN=eno PE=3 SV=1 76 497 3.0E-133
sp|Q5M561|ENO_STRT2 Enolase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=eno PE=3 SV=1 77 503 4.0E-133
sp|Q5M0M5|ENO_STRT1 Enolase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=eno PE=3 SV=1 77 503 4.0E-133
sp|B1V8R6|ENO_PHYAS Enolase OS=Phytoplasma australiense GN=eno PE=3 SV=1 77 497 4.0E-133
sp|Q8FQS7|ENO_COREF Enolase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=eno PE=3 SV=1 77 507 5.0E-133
sp|A6VJ31|ENO_METM7 Enolase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eno PE=3 SV=2 77 507 5.0E-133
sp|B1YLD8|ENO_EXIS2 Enolase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=eno PE=3 SV=1 77 503 5.0E-133
sp|Q03LI0|ENO_STRTD Enolase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=eno PE=3 SV=1 77 503 5.0E-133
sp|B5RLS2|ENO_BORDL Enolase OS=Borrelia duttonii (strain Ly) GN=eno PE=3 SV=1 77 511 9.0E-133
sp|A4W2T1|ENO_STRS2 Enolase OS=Streptococcus suis (strain 98HAH33) GN=eno PE=3 SV=1 77 505 9.0E-133
sp|P64081|ENO_STRA5 Enolase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=eno PE=3 SV=1 77 503 9.0E-133
sp|P64080|ENO_STRA3 Enolase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=eno PE=3 SV=1 77 503 9.0E-133
sp|Q3K2B2|ENO_STRA1 Enolase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=eno PE=3 SV=1 77 503 9.0E-133
sp|A8L149|ENO_FRASN Enolase OS=Frankia sp. (strain EAN1pec) GN=eno PE=3 SV=1 76 503 1.0E-132
sp|A1TEE4|ENO_MYCVP Enolase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=eno PE=3 SV=1 77 506 1.0E-132
sp|C6BSL8|ENO_DESAD Enolase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=eno PE=3 SV=1 77 509 1.0E-132
sp|B3EUH8|ENO_AMOA5 Enolase OS=Amoebophilus asiaticus (strain 5a2) GN=eno PE=3 SV=1 75 508 2.0E-132
sp|Q8RP81|ENO_STRAG Enolase OS=Streptococcus agalactiae GN=eno PE=1 SV=1 77 503 2.0E-132
sp|B1GYL7|ENO_UNCTG Enolase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=eno PE=3 SV=1 77 503 2.0E-132
sp|B0S1G7|ENO_FINM2 Enolase OS=Finegoldia magna (strain ATCC 29328) GN=eno PE=3 SV=1 76 503 2.0E-132
sp|C1A7Y3|ENO_GEMAT Enolase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=eno PE=3 SV=1 74 503 2.0E-132
sp|A3CMA7|ENO_STRSV Enolase OS=Streptococcus sanguinis (strain SK36) GN=eno PE=3 SV=1 77 503 2.0E-132
sp|Q1D401|ENO_MYXXD Enolase OS=Myxococcus xanthus (strain DK 1622) GN=eno PE=3 SV=1 77 511 2.0E-132
sp|A2C038|ENO_PROM1 Enolase OS=Prochlorococcus marinus (strain NATL1A) GN=eno PE=3 SV=1 75 503 2.0E-132
sp|A0PW55|ENO_MYCUA Enolase OS=Mycobacterium ulcerans (strain Agy99) GN=eno PE=3 SV=1 77 506 3.0E-132
sp|Q0STE0|ENO_CLOPS Enolase OS=Clostridium perfringens (strain SM101 / Type A) GN=eno PE=3 SV=1 75 505 3.0E-132
sp|Q0TQZ2|ENO_CLOP1 Enolase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=eno PE=3 SV=1 75 505 3.0E-132
sp|B1HVS4|ENO_LYSSC Enolase OS=Lysinibacillus sphaericus (strain C3-41) GN=eno PE=3 SV=1 77 503 3.0E-132
sp|Q8XKU4|ENO_CLOPE Enolase OS=Clostridium perfringens (strain 13 / Type A) GN=eno PE=3 SV=1 75 505 4.0E-132
sp|B2UY16|ENO_CLOBA Enolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=eno PE=3 SV=1 75 503 4.0E-132
sp|B5RRF1|ENO_BORRA Enolase OS=Borrelia recurrentis (strain A1) GN=eno PE=3 SV=1 77 511 4.0E-132
sp|C1CRM6|ENO_STRZT Enolase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=eno PE=3 SV=1 77 503 4.0E-132
sp|C1CKJ0|ENO_STRZP Enolase OS=Streptococcus pneumoniae (strain P1031) GN=eno PE=3 SV=1 77 503 4.0E-132
sp|C1CEB3|ENO_STRZJ Enolase OS=Streptococcus pneumoniae (strain JJA) GN=eno PE=3 SV=1 77 503 4.0E-132
sp|Q97QS2|ENO_STRPN Enolase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=eno PE=1 SV=1 77 503 4.0E-132
sp|B8ZPW9|ENO_STRPJ Enolase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=eno PE=3 SV=1 77 503 4.0E-132
sp|B1IBR3|ENO_STRPI Enolase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=eno PE=3 SV=1 77 503 4.0E-132
sp|C1C7C0|ENO_STRP7 Enolase OS=Streptococcus pneumoniae (strain 70585) GN=eno PE=3 SV=1 77 503 4.0E-132
sp|B5E4P1|ENO_STRP4 Enolase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=eno PE=3 SV=1 77 503 4.0E-132
sp|B9MS47|ENO_CALBD Enolase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=eno PE=3 SV=1 75 505 5.0E-132
sp|Q8YRB0|ENO_NOSS1 Enolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=eno PE=3 SV=1 76 503 5.0E-132
sp|Q9K717|ENO_BACHD Enolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=eno PE=3 SV=1 77 503 5.0E-132
sp|B2HDI5|ENO_MYCMM Enolase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=eno PE=3 SV=1 77 506 5.0E-132
sp|Q6MPQ2|ENO_BDEBA Enolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=eno PE=3 SV=1 77 501 6.0E-132
sp|A8MFY2|ENO_ALKOO Enolase OS=Alkaliphilus oremlandii (strain OhILAs) GN=eno PE=3 SV=1 77 505 6.0E-132
sp|A9BIS7|ENO_PETMO Enolase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=eno PE=3 SV=1 73 505 6.0E-132
sp|B7GTK2|ENO_BIFLS Enolase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=eno PE=3 SV=1 74 509 7.0E-132
sp|B1VFL0|ENO_CORU7 Enolase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=eno PE=3 SV=1 74 508 7.0E-132
sp|B2TPW4|ENO_CLOBB Enolase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=eno PE=3 SV=1 75 503 7.0E-132
sp|Q4L4K7|ENO_STAHJ Enolase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=eno PE=3 SV=1 77 503 7.0E-132
sp|Q2FQL9|ENO1_METHJ Enolase 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=eno1 PE=3 SV=1 74 503 8.0E-132
sp|Q5FNN5|ENO_GLUOX Enolase OS=Gluconobacter oxydans (strain 621H) GN=eno PE=3 SV=1 76 508 9.0E-132
sp|Q8DPS0|ENO_STRR6 Enolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=eno PE=1 SV=1 77 503 9.0E-132
sp|B2IPX8|ENO_STRPS Enolase OS=Streptococcus pneumoniae (strain CGSP14) GN=eno PE=3 SV=1 77 503 9.0E-132
sp|Q04KG2|ENO_STRP2 Enolase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=eno PE=3 SV=1 77 503 9.0E-132
sp|B2GAM0|ENO_LACF3 Enolase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=eno PE=3 SV=1 77 512 1.0E-131
sp|C5C987|ENO_MICLC Enolase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=eno PE=3 SV=1 77 507 1.0E-131
sp|Q741U7|ENO_MYCPA Enolase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=eno PE=3 SV=1 77 506 2.0E-131
sp|A0QBX4|ENO_MYCA1 Enolase OS=Mycobacterium avium (strain 104) GN=eno PE=3 SV=1 77 506 2.0E-131
sp|Q8EW32|ENO_MYCPE Enolase OS=Mycoplasma penetrans (strain HF-2) GN=eno PE=3 SV=1 77 510 2.0E-131
sp|C3KZ49|ENO_CLOB6 Enolase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=eno PE=3 SV=1 77 503 2.0E-131
sp|C1CXJ3|ENO_DEIDV Enolase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=eno PE=3 SV=1 75 510 3.0E-131
sp|B0TK04|ENO_SHEHH Enolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=eno PE=3 SV=1 77 503 3.0E-131
sp|Q46HG5|ENO_PROMT Enolase OS=Prochlorococcus marinus (strain NATL2A) GN=eno PE=3 SV=1 75 503 3.0E-131
sp|A2BUI5|ENO_PROM5 Enolase OS=Prochlorococcus marinus (strain MIT 9515) GN=eno PE=3 SV=1 72 503 3.0E-131
sp|A5V3E8|ENO_SPHWW Enolase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=eno PE=3 SV=1 74 510 3.0E-131
sp|B1MVW3|ENO_LEUCK Enolase OS=Leuconostoc citreum (strain KM20) GN=eno PE=3 SV=1 77 503 3.0E-131
sp|A1SF66|ENO_NOCSJ Enolase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=eno PE=3 SV=1 74 503 4.0E-131
sp|Q21V37|ENO_RHOFT Enolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=eno PE=3 SV=1 76 503 4.0E-131
sp|Q7V483|ENO_PROMM Enolase OS=Prochlorococcus marinus (strain MIT 9313) GN=eno PE=3 SV=1 75 503 5.0E-131
sp|A9BDH2|ENO_PROM4 Enolase OS=Prochlorococcus marinus (strain MIT 9211) GN=eno PE=3 SV=1 75 505 5.0E-131
sp|B9M3M1|ENO_GEODF Enolase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=eno PE=3 SV=1 77 503 5.0E-131
sp|A8AY46|ENO_STRGC Enolase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=eno PE=3 SV=1 77 503 5.0E-131
sp|A8H1S5|ENO_SHEPA Enolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=eno PE=3 SV=1 77 503 5.0E-131
sp|A2CDE2|ENO_PROM3 Enolase OS=Prochlorococcus marinus (strain MIT 9303) GN=eno PE=3 SV=1 75 503 5.0E-131
sp|Q215A2|ENO_RHOPB Enolase OS=Rhodopseudomonas palustris (strain BisB18) GN=eno PE=3 SV=1 74 509 6.0E-131
sp|Q0RCG8|ENO_FRAAA Enolase OS=Frankia alni (strain ACN14a) GN=eno PE=3 SV=2 76 497 7.0E-131
sp|A1W4R1|ENO_ACISJ Enolase OS=Acidovorax sp. (strain JS42) GN=eno PE=3 SV=1 76 503 8.0E-131
sp|Q2G662|ENO_NOVAD Enolase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=eno PE=3 SV=1 74 503 9.0E-131
sp|B6YQN5|ENO_AZOPC Enolase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=eno PE=3 SV=1 75 502 9.0E-131
sp|Q8G5I9|ENO_BIFLO Enolase OS=Bifidobacterium longum (strain NCC 2705) GN=eno PE=3 SV=1 74 509 1.0E-130
sp|B3DSV2|ENO_BIFLD Enolase OS=Bifidobacterium longum (strain DJO10A) GN=eno PE=3 SV=1 74 509 1.0E-130
sp|Q1WSY0|ENO_LACS1 Enolase OS=Lactobacillus salivarius (strain UCC118) GN=eno PE=3 SV=1 76 505 1.0E-130
sp|A4T6L5|ENO_MYCGI Enolase OS=Mycobacterium gilvum (strain PYR-GCK) GN=eno PE=3 SV=1 77 506 1.0E-130
sp|Q1JML5|ENO_STRPC Enolase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|Q1JCN8|ENO_STRPB Enolase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|A1TLS5|ENO_ACIAC Enolase OS=Acidovorax citrulli (strain AAC00-1) GN=eno PE=3 SV=1 76 503 1.0E-130
sp|Q9XDS7|ENO_STRIT Enolase OS=Streptococcus intermedius GN=eno PE=3 SV=1 77 503 1.0E-130
sp|Q5SME1|ENO_THET8 Enolase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=eno PE=3 SV=1 74 503 1.0E-130
sp|Q72H85|ENO_THET2 Enolase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=eno PE=3 SV=1 74 503 1.0E-130
sp|Q050L5|ENO_LEPBL Enolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|Q04SI9|ENO_LEPBJ Enolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|B5XKM7|ENO_STRPZ Enolase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|P0DA95|ENO_STRPQ Enolase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|Q48UF7|ENO_STRPM Enolase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|A2RFE3|ENO_STRPG Enolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|Q1J7I5|ENO_STRPF Enolase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|Q1JHQ6|ENO_STRPD Enolase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|P69951|ENO_STRP8 Enolase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=eno PE=3 SV=2 77 503 1.0E-130
sp|P0DA94|ENO_STRP3 Enolase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=eno PE=3 SV=1 77 503 1.0E-130
sp|P69949|ENO_STRP1 Enolase OS=Streptococcus pyogenes serotype M1 GN=eno PE=3 SV=2 77 503 1.0E-130
sp|Q47WR1|ENO_COLP3 Enolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|B9EAH1|ENO_MACCJ Enolase OS=Macrococcus caseolyticus (strain JCSC5402) GN=eno PE=3 SV=1 77 505 2.0E-130
sp|Q5XD01|ENO_STRP6 Enolase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=eno PE=1 SV=3 77 503 2.0E-130
sp|C0MH89|ENO_STRS7 Enolase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|B4U2B8|ENO_STREM Enolase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|C0M6K5|ENO_STRE4 Enolase OS=Streptococcus equi subsp. equi (strain 4047) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|B2J1R2|ENO_NOSP7 Enolase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=eno PE=3 SV=1 76 503 2.0E-130
sp|Q2SSR3|ENO_MYCCT Enolase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|Q0C0R3|ENO_HYPNA Enolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|Q8CPY3|ENO_STAES Enolase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|Q5HQV0|ENO_STAEQ Enolase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=eno PE=3 SV=1 77 503 2.0E-130
sp|B7KL24|ENO_CYAP7 Enolase OS=Cyanothece sp. (strain PCC 7424) GN=eno PE=3 SV=1 77 502 3.0E-130
sp|B8HQY9|ENO_CYAP4 Enolase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=eno PE=3 SV=1 73 503 3.0E-130
sp|A5FRM5|ENO_DEHMB Enolase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=eno PE=3 SV=1 77 503 4.0E-130
sp|Q2NJ39|ENO_AYWBP Enolase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=eno PE=3 SV=1 77 495 4.0E-130
sp|B7JW48|ENO_CYAP8 Enolase OS=Cyanothece sp. (strain PCC 8801) GN=eno PE=3 SV=1 77 506 4.0E-130
sp|Q0I6K2|ENO_SYNS3 Enolase OS=Synechococcus sp. (strain CC9311) GN=eno PE=3 SV=1 75 503 5.0E-130
sp|Q0S4I1|ENO_RHOJR Enolase OS=Rhodococcus jostii (strain RHA1) GN=eno PE=3 SV=1 77 506 5.0E-130
sp|Q2IID9|ENO_ANADE Enolase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=eno PE=3 SV=1 77 510 5.0E-130
sp|Q89KV6|ENO_BRADU Enolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=eno PE=3 SV=1 74 510 5.0E-130
sp|C0QRV6|ENO_PERMH Enolase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=eno PE=3 SV=1 77 503 6.0E-130
sp|Q1ISS7|ENO_KORVE Enolase OS=Koribacter versatilis (strain Ellin345) GN=eno PE=3 SV=1 77 503 6.0E-130
sp|P64079|ENO_STAAW Enolase OS=Staphylococcus aureus (strain MW2) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|A8Z1A4|ENO_STAAT Enolase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|Q6GB54|ENO_STAAS Enolase OS=Staphylococcus aureus (strain MSSA476) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|Q6GIL4|ENO_STAAR Enolase OS=Staphylococcus aureus (strain MRSA252) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|P99088|ENO_STAAN Enolase OS=Staphylococcus aureus (strain N315) GN=eno PE=1 SV=1 77 503 7.0E-130
sp|P64078|ENO_STAAM Enolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|A6QF85|ENO_STAAE Enolase OS=Staphylococcus aureus (strain Newman) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|Q5HHP1|ENO_STAAC Enolase OS=Staphylococcus aureus (strain COL) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|Q2YSE8|ENO_STAAB Enolase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|A5IQY0|ENO_STAA9 Enolase OS=Staphylococcus aureus (strain JH9) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|Q2G028|ENO_STAA8 Enolase OS=Staphylococcus aureus (strain NCTC 8325) GN=eno PE=1 SV=1 77 503 7.0E-130
sp|Q2FIL7|ENO_STAA3 Enolase OS=Staphylococcus aureus (strain USA300) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|A6TZQ5|ENO_STAA2 Enolase OS=Staphylococcus aureus (strain JH1) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|A7WZT2|ENO_STAA1 Enolase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=eno PE=3 SV=1 77 503 7.0E-130
sp|B8JAC4|ENO_ANAD2 Enolase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=eno PE=3 SV=1 77 510 7.0E-130
sp|B4RMD8|ENO_NEIG2 Enolase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=eno PE=3 SV=1 76 503 7.0E-130
sp|Q5F8Z2|ENO_NEIG1 Enolase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=eno PE=3 SV=1 76 503 7.0E-130
sp|Q07ND9|ENO_RHOP5 Enolase OS=Rhodopseudomonas palustris (strain BisA53) GN=eno PE=3 SV=1 74 510 7.0E-130
sp|Q3AVW5|ENO_SYNS9 Enolase OS=Synechococcus sp. (strain CC9902) GN=eno PE=3 SV=1 75 503 8.0E-130
sp|Q8PLS0|ENO_XANAC Enolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=eno PE=3 SV=1 74 503 8.0E-130
sp|C1AY93|ENO_RHOOB Enolase OS=Rhodococcus opacus (strain B4) GN=eno PE=3 SV=1 77 506 9.0E-130
sp|Q49W03|ENO_STAS1 Enolase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=eno PE=3 SV=1 77 503 9.0E-130
sp|A5GEW5|ENO_GEOUR Enolase OS=Geobacter uraniireducens (strain Rf4) GN=eno PE=3 SV=1 77 503 9.0E-130
sp|Q110V4|ENO_TRIEI Enolase OS=Trichodesmium erythraeum (strain IMS101) GN=eno PE=3 SV=1 76 503 1.0E-129
sp|Q7U3T1|ENO_SYNPX Enolase OS=Synechococcus sp. (strain WH8102) GN=eno PE=3 SV=1 75 503 1.0E-129
sp|Q8P9Z3|ENO_XANCP Enolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=eno PE=3 SV=1 74 503 1.0E-129
sp|B0RU05|ENO_XANCB Enolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=eno PE=3 SV=1 74 503 1.0E-129
sp|Q4UTP2|ENO_XANC8 Enolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=eno PE=3 SV=1 74 503 1.0E-129
sp|Q6YQT9|ENO_ONYPE Enolase OS=Onion yellows phytoplasma (strain OY-M) GN=eno PE=3 SV=1 77 495 1.0E-129
sp|Q3BUT0|ENO_XANC5 Enolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=eno PE=3 SV=1 74 503 1.0E-129
sp|B2V9N8|ENO_SULSY Enolase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=eno PE=3 SV=1 77 508 1.0E-129
sp|Q3A578|ENO_PELCD Enolase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=eno PE=3 SV=1 77 505 1.0E-129
sp|A1S4D7|ENO_SHEAM Enolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=eno PE=3 SV=1 77 503 1.0E-129
sp|B4UDM8|ENO_ANASK Enolase OS=Anaeromyxobacter sp. (strain K) GN=eno PE=3 SV=1 77 503 1.0E-129
sp|Q8DTS9|ENO_STRMU Enolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=eno PE=1 SV=1 77 503 1.0E-129
sp|Q47DI1|ENO_DECAR Enolase OS=Dechloromonas aromatica (strain RCB) GN=eno PE=3 SV=1 76 503 1.0E-129
sp|A4YVC0|ENO_BRASO Enolase OS=Bradyrhizobium sp. (strain ORS278) GN=eno PE=3 SV=1 74 510 1.0E-129
sp|Q7UIR2|ENO_RHOBA Enolase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=eno PE=3 SV=1 77 510 1.0E-129
sp|A9NF93|ENO_ACHLI Enolase OS=Acholeplasma laidlawii (strain PG-8A) GN=eno PE=3 SV=1 77 505 2.0E-129
sp|P77972|ENO_SYNY3 Enolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=eno PE=3 SV=1 77 502 2.0E-129
sp|B1Y4K4|ENO_LEPCP Enolase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=eno PE=3 SV=1 76 503 2.0E-129
sp|Q5GYK4|ENO_XANOR Enolase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=eno PE=3 SV=2 74 503 2.0E-129
sp|B2SUA6|ENO_XANOP Enolase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=eno PE=3 SV=1 74 503 2.0E-129
sp|Q2P1K8|ENO_XANOM Enolase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=eno PE=3 SV=1 74 503 2.0E-129
sp|O69174|ENO_STAAU Enolase OS=Staphylococcus aureus GN=eno PE=1 SV=1 77 503 2.0E-129
sp|Q3ZX11|ENO_DEHMC Enolase OS=Dehalococcoides mccartyi (strain CBDB1) GN=eno PE=3 SV=1 77 503 2.0E-129
sp|Q03ZK4|ENO_LEUMM Enolase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=eno PE=3 SV=1 77 503 3.0E-129
sp|Q3SL43|ENO_THIDA Enolase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=eno PE=3 SV=1 76 508 3.0E-129
sp|Q9CD42|ENO_MYCLE Enolase OS=Mycobacterium leprae (strain TN) GN=eno PE=3 SV=2 77 503 3.0E-129
sp|B3EL51|ENO_CHLPB Enolase OS=Chlorobium phaeobacteroides (strain BS1) GN=eno PE=3 SV=1 77 503 3.0E-129
sp|A4X3B7|ENO_SALTO Enolase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=eno PE=3 SV=1 77 509 3.0E-129
sp|B9DRR9|ENO_STRU0 Enolase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=eno PE=3 SV=1 77 503 3.0E-129
sp|Q6MTZ2|ENO_MYCMS Enolase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=eno PE=3 SV=1 77 503 3.0E-129
sp|B2S044|ENO_BORHD Enolase OS=Borrelia hermsii (strain HS1 / DAH) GN=eno PE=3 SV=1 77 503 3.0E-129
sp|A8M2Y3|ENO_SALAI Enolase OS=Salinispora arenicola (strain CNS-205) GN=eno PE=3 SV=1 77 509 3.0E-129
sp|Q136E5|ENO_RHOPS Enolase OS=Rhodopseudomonas palustris (strain BisB5) GN=eno PE=3 SV=1 74 509 3.0E-129
sp|Q0BKV1|ENO_FRATO Enolase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=eno PE=3 SV=1 77 503 3.0E-129
sp|Q2IWD0|ENO_RHOP2 Enolase OS=Rhodopseudomonas palustris (strain HaA2) GN=eno PE=3 SV=1 74 509 3.0E-129
sp|A0Q5J9|ENO_FRATN Enolase OS=Francisella tularensis subsp. novicida (strain U112) GN=eno PE=3 SV=1 77 503 4.0E-129
sp|A9LZL4|ENO_NEIM0 Enolase OS=Neisseria meningitidis serogroup C (strain 053442) GN=eno PE=3 SV=1 76 503 4.0E-129
sp|A5GPE0|ENO_SYNPW Enolase OS=Synechococcus sp. (strain WH7803) GN=eno PE=3 SV=1 75 503 4.0E-129
sp|Q3Z8W4|ENO_DEHM1 Enolase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=eno PE=3 SV=1 77 503 4.0E-129
sp|Q74AR6|ENO_GEOSL Enolase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=eno PE=3 SV=1 77 505 4.0E-129
sp|Q2A278|ENO_FRATH Enolase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=eno PE=3 SV=1 77 503 5.0E-129
sp|B0C9F0|ENO_ACAM1 Enolase OS=Acaryochloris marina (strain MBIC 11017) GN=eno PE=3 SV=1 77 503 5.0E-129
sp|Q3SRK4|ENO_NITWN Enolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=eno PE=3 SV=1 74 510 6.0E-129
sp|A3DBQ5|ENO_CLOTH Enolase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=eno PE=3 SV=1 75 503 7.0E-129
sp|B2KBA5|ENO_ELUMP Enolase OS=Elusimicrobium minutum (strain Pei191) GN=eno PE=3 SV=1 77 502 9.0E-129
sp|Q9HXZ5|ENO_PSEAE Enolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=eno PE=3 SV=1 77 507 1.0E-128
sp|Q02RA7|ENO_PSEAB Enolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=eno PE=1 SV=1 77 507 1.0E-128
sp|B7V7V4|ENO_PSEA8 Enolase OS=Pseudomonas aeruginosa (strain LESB58) GN=eno PE=3 SV=1 77 507 1.0E-128
sp|A6V1F3|ENO_PSEA7 Enolase OS=Pseudomonas aeruginosa (strain PA7) GN=eno PE=3 SV=1 77 507 1.0E-128
sp|A5FUW3|ENO_ACICJ Enolase OS=Acidiphilium cryptum (strain JF-5) GN=eno PE=3 SV=1 76 503 1.0E-128
sp|Q2W698|ENO_MAGSA Enolase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=eno PE=3 SV=1 74 508 1.0E-128
sp|B2FK88|ENO_STRMK Enolase OS=Stenotrophomonas maltophilia (strain K279a) GN=eno PE=3 SV=1 77 503 1.0E-128
sp|Q1MS78|ENO_LAWIP Enolase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=eno PE=3 SV=1 74 509 1.0E-128
sp|Q0BSX3|ENO_GRABC Enolase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=eno PE=3 SV=1 74 503 2.0E-128
sp|Q7VDY0|ENO_PROMA Enolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=eno PE=3 SV=1 75 503 2.0E-128
sp|Q9JU46|ENO_NEIMA Enolase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=eno PE=3 SV=1 76 501 2.0E-128
sp|C4LHL7|ENO_CORK4 Enolase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=eno PE=3 SV=1 77 503 2.0E-128
sp|Q9JZ53|ENO_NEIMB Enolase OS=Neisseria meningitidis serogroup B (strain MC58) GN=eno PE=3 SV=1 76 501 2.0E-128
sp|Q1QZX7|ENO_CHRSD Enolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=eno PE=3 SV=1 77 503 2.0E-128
sp|Q0HXH0|ENO_SHESR Enolase OS=Shewanella sp. (strain MR-7) GN=eno PE=3 SV=1 77 503 2.0E-128
sp|Q0HL72|ENO_SHESM Enolase OS=Shewanella sp. (strain MR-4) GN=eno PE=3 SV=1 77 503 2.0E-128
sp|A4G737|ENO_HERAR Enolase OS=Herminiimonas arsenicoxydans GN=eno PE=3 SV=1 76 505 3.0E-128
sp|Q5WDK9|ENO_BACSK Enolase OS=Bacillus clausii (strain KSM-K16) GN=eno PE=3 SV=1 77 503 3.0E-128
sp|Q2FLB5|ENO2_METHJ Enolase 2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=eno2 PE=3 SV=1 77 511 3.0E-128
sp|A5WG13|ENO_PSYWF Enolase OS=Psychrobacter sp. (strain PRwf-1) GN=eno PE=3 SV=1 77 503 3.0E-128
sp|Q28RE8|ENO_JANSC Enolase OS=Jannaschia sp. (strain CCS1) GN=eno PE=3 SV=1 77 508 3.0E-128
sp|Q1GI52|ENO_RUEST Enolase OS=Ruegeria sp. (strain TM1040) GN=eno PE=3 SV=1 77 508 3.0E-128
sp|Q9RR60|ENO_DEIRA Enolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=eno PE=3 SV=1 75 510 3.0E-128
sp|B0JMP6|ENO_MICAN Enolase OS=Microcystis aeruginosa (strain NIES-843) GN=eno PE=3 SV=1 77 506 3.0E-128
sp|Q316Q0|ENO_DESAG Enolase OS=Desulfovibrio alaskensis (strain G20) GN=eno PE=3 SV=1 77 504 4.0E-128
sp|A0KU82|ENO_SHESA Enolase OS=Shewanella sp. (strain ANA-3) GN=eno PE=3 SV=1 77 503 5.0E-128
sp|A7INB6|ENO_XANP2 Enolase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=eno PE=3 SV=1 74 501 5.0E-128
sp|Q39T27|ENO_GEOMG Enolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=eno PE=3 SV=1 77 508 5.0E-128
sp|Q5NGW8|ENO_FRATT Enolase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=eno PE=3 SV=1 77 503 5.0E-128
sp|Q14IC0|ENO_FRAT1 Enolase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=eno PE=3 SV=1 77 503 5.0E-128
sp|A5EK13|ENO_BRASB Enolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=eno PE=3 SV=1 74 510 6.0E-128
sp|Q8DL40|ENO_THEEB Enolase OS=Thermosynechococcus elongatus (strain BP-1) GN=eno PE=3 SV=1 76 502 7.0E-128
sp|B0SYX8|ENO_CAUSK Enolase OS=Caulobacter sp. (strain K31) GN=eno PE=3 SV=1 77 503 7.0E-128
sp|B0V677|ENO_ACIBY Enolase OS=Acinetobacter baumannii (strain AYE) GN=eno PE=3 SV=1 73 511 7.0E-128
sp|A1APJ8|ENO_PELPD Enolase OS=Pelobacter propionicus (strain DSM 2379) GN=eno PE=3 SV=1 77 503 8.0E-128
sp|C0R5N4|ENO_WOLWR Enolase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=eno PE=3 SV=1 77 501 8.0E-128
sp|B4SR86|ENO_STRM5 Enolase OS=Stenotrophomonas maltophilia (strain R551-3) GN=eno PE=3 SV=1 77 503 8.0E-128
sp|A9HJ75|ENO_GLUDA Enolase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=eno PE=3 SV=1 76 508 8.0E-128
sp|B5XV19|ENO_KLEP3 Enolase OS=Klebsiella pneumoniae (strain 342) GN=eno PE=3 SV=1 77 503 8.0E-128
sp|B8EJT3|ENO_METSB Enolase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=eno PE=3 SV=1 74 510 9.0E-128
sp|B2IKR4|ENO_BEII9 Enolase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=eno PE=3 SV=1 74 510 1.0E-127
sp|Q3AGS4|ENO_SYNSC Enolase OS=Synechococcus sp. (strain CC9605) GN=eno PE=3 SV=1 75 503 1.0E-127
sp|P9WNL1|ENO_MYCTU Enolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=eno PE=1 SV=1 77 506 1.0E-127
sp|P9WNL0|ENO_MYCTO Enolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=eno PE=3 SV=1 77 506 1.0E-127
sp|A1QQ97|ENO_MYCTF Enolase OS=Mycobacterium tuberculosis (strain F11) GN=eno PE=3 SV=1 77 506 1.0E-127
sp|A5U166|ENO_MYCTA Enolase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=eno PE=3 SV=1 77 506 1.0E-127
sp|Q8ENP5|ENO_OCEIH Enolase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=eno PE=3 SV=1 77 503 1.0E-127
sp|C5CSV6|ENO_VARPS Enolase OS=Variovorax paradoxus (strain S110) GN=eno PE=3 SV=1 76 503 1.0E-127
sp|A6SXG3|ENO_JANMA Enolase OS=Janthinobacterium sp. (strain Marseille) GN=eno PE=3 SV=1 76 503 1.0E-127
sp|A6TD53|ENO_KLEP7 Enolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=eno PE=3 SV=1 77 503 1.0E-127
sp|A9W6G9|ENO_METEP Enolase OS=Methylobacterium extorquens (strain PA1) GN=eno PE=3 SV=1 74 503 2.0E-127
sp|B9DJJ9|ENO_STACT Enolase OS=Staphylococcus carnosus (strain TM300) GN=eno PE=3 SV=1 77 503 2.0E-127
sp|Q4ZWQ8|ENO1_PSEU2 Enolase 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=eno1 PE=3 SV=1 77 507 2.0E-127
sp|Q1QMI9|ENO_NITHX Enolase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=eno PE=3 SV=1 74 510 2.0E-127
sp|Q8EBR0|ENO_SHEON Enolase OS=Shewanella oneidensis (strain MR-1) GN=eno PE=3 SV=2 77 503 2.0E-127
sp|Q6FAT9|ENO_ACIAD Enolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=eno PE=3 SV=1 73 511 2.0E-127
sp|C1AM14|ENO_MYCBT Enolase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=eno PE=3 SV=1 77 506 2.0E-127
sp|A1KHG1|ENO_MYCBP Enolase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=eno PE=3 SV=1 77 506 2.0E-127
sp|Q7U0U6|ENO_MYCBO Enolase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=eno PE=3 SV=1 77 506 2.0E-127
sp|B6JFY2|ENO_OLICO Enolase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=eno PE=3 SV=1 74 510 3.0E-127
sp|A6VR00|ENO_ACTSZ Enolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=eno PE=3 SV=1 77 503 3.0E-127
sp|B0VQI4|ENO_ACIBS Enolase OS=Acinetobacter baumannii (strain SDF) GN=eno PE=3 SV=1 73 503 3.0E-127
sp|A2SJR2|ENO_METPP Enolase OS=Methylibium petroleiphilum (strain PM1) GN=eno PE=3 SV=1 76 503 3.0E-127
sp|Q3YY77|ENO_SHISS Enolase OS=Shigella sonnei (strain Ss046) GN=eno PE=3 SV=1 77 503 3.0E-127
sp|Q12PZ4|ENO_SHEDO Enolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=eno PE=3 SV=1 77 503 4.0E-127
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup198
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3243 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|3244
Ophiocordyceps australis map64 (Brazil) OphauB2|5568
Ophiocordyceps australis map64 (Brazil) OphauB2|5569
Ophiocordyceps camponoti-floridani Ophcf2|00105
Ophiocordyceps camponoti-floridani Ophcf2|00107
Ophiocordyceps camponoti-rufipedis Ophun1|2275
Ophiocordyceps camponoti-rufipedis Ophun1|2276
Ophiocordyceps kimflemingae Ophio5|7488
Ophiocordyceps kimflemingae Ophio5|868
Ophiocordyceps subramaniannii Hirsu2|8357
Ophiocordyceps subramaniannii Hirsu2|8359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3243
METLTEYFTQRARTGCNSGQCLSPHHSSKLLALKAAADPPSERSIPNSEGRSSLLRHTSLLQLSQIAHFRTDFIM
AITKVHARSVYDSRGNPTVEVDVVTETGLHRAIVPSGASTGQHEACELRDGDKTKWGGKGVTKAVNNVNTVIGPA
LIKEGIDVKDQSKVDDFLNKLDGTANKTKLGANSILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPFM
NVLNGGSHAGGRLAFQEFMVVPSEAPSFSEAMRQGAEVYQQLKSLAKKKYGLSAGNVGDEGGVAPDIQTATEALD
LITESIEKAGYTGKVKIAMDVASSEFYKATEKKYDLDYKNPESDPSKWITYEELAAMYSDLCKKYPIVSIEDPFA
EDDWEAWSYFYKMQDCQIVGDDLTVTNPLRIKKAIELKACNALLLKVNQIGTLTESIQAAKDSYADGWGVMVSHR
SGETEDVTISDIVVGIRSGEIKTGAPCRSERLAKLNQILRIEEELGDKAIYAGPNFRKAVNL*
Coding >OphauG2|3243
ATGGAGACATTAACAGAATACTTTACGCAAAGAGCTCGCACAGGCTGTAACTCGGGTCAATGCTTATCGCCCCAC
CACAGCAGCAAGCTGCTAGCACTGAAAGCAGCTGCAGACCCTCCCTCGGAGCGCTCCATTCCCAACAGTGAAGGA
AGGTCCAGTCTTCTTAGACACACTTCTCTCCTCCAGCTCAGCCAGATTGCACATTTTCGCACAGACTTCATAATG
GCCATCACAAAGGTCCACGCACGCTCTGTCTATGACTCTCGCGGAAACCCCACTGTTGAAGTGGACGTGGTTACC
GAGACGGGTCTGCACCGCGCCATCGTCCCGTCTGGCGCCTCGACGGGTCAGCATGAGGCCTGTGAGCTCCGAGAC
GGCGACAAGACCAAGTGGGGCGGCAAGGGCGTTACCAAGGCTGTCAACAATGTCAACACTGTCATCGGCCCTGCC
CTCATCAAGGAGGGTATTGATGTCAAAGACCAATCCAAGGTCGATGACTTTCTCAACAAGCTCGACGGTACTGCC
AACAAGACTAAGCTTGGTGCCAATTCCATTCTCGGTGTGAGCCTGGCTGTGGCCAAGGCTGGTGCCGCCGAGAAG
GGAGTTCCCCTGTATGCCCACATATCGGACCTTGCTGGTACCAAGAAGCCCTACGTTCTTCCTGTGCCATTTATG
AATGTCCTCAATGGAGGCTCCCATGCTGGAGGCCGCCTTGCTTTCCAGGAGTTCATGGTTGTTCCAAGCGAAGCA
CCCAGTTTCTCGGAGGCTATGCGCCAGGGTGCTGAGGTGTATCAGCAGCTCAAGAGCCTGGCTAAGAAGAAGTAT
GGCCTGTCAGCAGGTAATGTTGGTGACGAGGGCGGCGTTGCCCCCGATATCCAGACTGCTACTGAGGCTCTTGAT
CTCATTACCGAGTCCATTGAGAAGGCTGGGTATACTGGCAAGGTCAAAATTGCCATGGATGTGGCCTCAAGCGAG
TTCTACAAGGCCACTGAAAAGAAGTACGATCTCGACTACAAGAACCCTGAGAGCGACCCAAGCAAGTGGATCACG
TATGAGGAGCTGGCAGCCATGTACTCGGATTTGTGCAAAAAGTACCCCATTGTCTCTATCGAGGATCCCTTCGCC
GAGGACGACTGGGAGGCCTGGTCCTACTTTTACAAGATGCAGGACTGCCAGATTGTGGGCGATGACTTGACGGTG
ACTAACCCGCTGCGCATCAAAAAGGCCATTGAGCTCAAGGCTTGCAATGCCCTGCTTCTCAAGGTGAACCAAATT
GGTACCTTGACAGAGTCTATTCAGGCTGCCAAGGACTCGTATGCCGACGGTTGGGGTGTCATGGTGTCGCACCGA
TCTGGCGAGACAGAAGATGTGACTATTTCGGACATTGTTGTCGGAATTCGGTCCGGCGAGATCAAGACTGGTGCT
CCTTGCCGCTCAGAGCGTCTTGCCAAGCTCAACCAGATTCTGCGCATTGAGGAGGAGTTGGGCGACAAGGCCATC
TATGCAGGCCCCAATTTCCGCAAGGCTGTTAATCTGTAG
Transcript >OphauG2|3243
ATGGAGACATTAACAGAATACTTTACGCAAAGAGCTCGCACAGGCTGTAACTCGGGTCAATGCTTATCGCCCCAC
CACAGCAGCAAGCTGCTAGCACTGAAAGCAGCTGCAGACCCTCCCTCGGAGCGCTCCATTCCCAACAGTGAAGGA
AGGTCCAGTCTTCTTAGACACACTTCTCTCCTCCAGCTCAGCCAGATTGCACATTTTCGCACAGACTTCATAATG
GCCATCACAAAGGTCCACGCACGCTCTGTCTATGACTCTCGCGGAAACCCCACTGTTGAAGTGGACGTGGTTACC
GAGACGGGTCTGCACCGCGCCATCGTCCCGTCTGGCGCCTCGACGGGTCAGCATGAGGCCTGTGAGCTCCGAGAC
GGCGACAAGACCAAGTGGGGCGGCAAGGGCGTTACCAAGGCTGTCAACAATGTCAACACTGTCATCGGCCCTGCC
CTCATCAAGGAGGGTATTGATGTCAAAGACCAATCCAAGGTCGATGACTTTCTCAACAAGCTCGACGGTACTGCC
AACAAGACTAAGCTTGGTGCCAATTCCATTCTCGGTGTGAGCCTGGCTGTGGCCAAGGCTGGTGCCGCCGAGAAG
GGAGTTCCCCTGTATGCCCACATATCGGACCTTGCTGGTACCAAGAAGCCCTACGTTCTTCCTGTGCCATTTATG
AATGTCCTCAATGGAGGCTCCCATGCTGGAGGCCGCCTTGCTTTCCAGGAGTTCATGGTTGTTCCAAGCGAAGCA
CCCAGTTTCTCGGAGGCTATGCGCCAGGGTGCTGAGGTGTATCAGCAGCTCAAGAGCCTGGCTAAGAAGAAGTAT
GGCCTGTCAGCAGGTAATGTTGGTGACGAGGGCGGCGTTGCCCCCGATATCCAGACTGCTACTGAGGCTCTTGAT
CTCATTACCGAGTCCATTGAGAAGGCTGGGTATACTGGCAAGGTCAAAATTGCCATGGATGTGGCCTCAAGCGAG
TTCTACAAGGCCACTGAAAAGAAGTACGATCTCGACTACAAGAACCCTGAGAGCGACCCAAGCAAGTGGATCACG
TATGAGGAGCTGGCAGCCATGTACTCGGATTTGTGCAAAAAGTACCCCATTGTCTCTATCGAGGATCCCTTCGCC
GAGGACGACTGGGAGGCCTGGTCCTACTTTTACAAGATGCAGGACTGCCAGATTGTGGGCGATGACTTGACGGTG
ACTAACCCGCTGCGCATCAAAAAGGCCATTGAGCTCAAGGCTTGCAATGCCCTGCTTCTCAAGGTGAACCAAATT
GGTACCTTGACAGAGTCTATTCAGGCTGCCAAGGACTCGTATGCCGACGGTTGGGGTGTCATGGTGTCGCACCGA
TCTGGCGAGACAGAAGATGTGACTATTTCGGACATTGTTGTCGGAATTCGGTCCGGCGAGATCAAGACTGGTGCT
CCTTGCCGCTCAGAGCGTCTTGCCAAGCTCAACCAGATTCTGCGCATTGAGGAGGAGTTGGGCGACAAGGCCATC
TATGCAGGCCCCAATTTCCGCAAGGCTGTTAATCTGTAG
Gene >OphauG2|3243
ATGGAGACATTAACAGAATACTTTACGCAAAGAGCTCGCACAGGCTGTAACTCGGGTCAATGCTTATCGCCCCAC
CACAGCAGCAAGCTGCTAGCACTGAAAGCAGCTGCAGACCCTCCCTCGGAGCGCTCCATTCCCAACAGTGAAGGA
AGGTCCAGTCTTCTTAGACACACTTCTCTCGTTCTTTTTTCTTCTCGTTTTTTTTCTCCCCTCGACTCCAACAAA
TTTGTCTCATACTAGCCTCTCTCCCCACGACACTCTTTCACCTTCATCACCCCGACTCTAGCTCCAGGTATGCTC
CCTATACAGAATTGAAGACAGACCCTCCATTGCGAGACCAGGTTCTGTCTGCTACCCCGCCGAGCTCATCACTCC
TACACCACCCGTCACCTGGCTGCTTCCCCTCTTGTCACGCAGGAAGAGGAGGGCTTTCGGCGTTTCCTAATCTAG
AACGTGTAGACGGAAGACTTTGAATCATGATTCTACTTCACTCGTTCCCAATTCTTTTTCGCCTCTCCTCACATA
CCCCGCCTTGTTTCGCACAGCAAGACTTGTTCTGTTTTCCTTGCTGATACATAGGACGATTTAGCTCAGCCAGAT
TGCACATTTTCGCACAGACTTCATAATGGCCATCACAAAGGTCCACGCACGCTCTGTCTATGACTCTCGCGGAAA
CCCCACTGTTGAAGTGGACGTGGTTACCGAGACGGGTCTGCACCGCGCCATCGTCCCGTCTGGCGCCTCGACGGG
TTAGTCCCCAGCCGTCTTTCTCCTTCTCGTACAAACAAGTAACATTGCGTCCAGGTCAGCATGAGGCCTGTGAGC
TCCGAGACGGCGACAAGACCAAGTGGGGCGGCAAGGGCGTTACCAAGGCTGTCAACAATGTCAACACTGTCATCG
GCCCTGCCCTCATCAAGGAGGGTATTGATGTCAAAGACCAATCCAAGGTCGATGACTTTCTCAACAAGCTCGACG
GTACTGCCAACAAGACTAAGCTTGGTGCCAATTCCATTCTCGGTGTGAGCCTGGCTGTGGCCAAGGCTGGTGCCG
CCGAGAAGGTCAGAGCTGATGAATCGATCGTGGGCACGGGGAAATTGGAATTTTTTTTTCGCTAATTATGCCAGT
AGGGAGTTCCCCTGTATGCCCACATATCGGACCTTGCTGGTACCAAGAAGCCCTACGTTCTTCCTGTGCCATTTA
TGAATGTCCTCAATGGAGGGTGAGTCTCAATTTTGACATGGACTAGTTGTAGAGTGAGCGTAACTGACACGAAGC
AGCTCCCATGCTGGAGGCCGCCTTGCTTTCCAGGAGTTCATGGTTGTTCCAAGGTACGTGGGCAAGCCATTGTCT
TTGTCGAGTCAGACCTGTGGCAGCAGCCCTCTAATGTACAATTAGCGAAGCACCCAGTTTCTCGGAGGCTATGCG
CCAGGGTGCTGAGGTGTATCAGCAGCTCAAGAGCCTGGCTAAGAAGAAGTATGGCCTGTCAGCAGGTAATGTTGG
TGACGAGGGCGGCGTTGCCCCCGATATCCAGACTGCTACTGAGGCTCTTGATCTCATTACCGAGTCCATTGAGAA
GGCTGGGTATACTGGCAAGGTCAAAATTGCCATGGATGTGGCCTCAAGCGAGTTCTACAAGGCCACTGAAAAGAA
GTACGATCTCGACTACAAGAACCCTGAGAGCGACCCAAGCAAGTGGATCACGTATGAGGAGCTGGCAGCCATGTA
CTCGGATTTGTGCAAAAAGTACCCCATTGTCTCTATCGAGGATCCCTTCGCCGAGGACGACTGGGAGGCCTGGTC
CTACTTTTACAAGATGCAGGACTGCCAGATTGTGGGCGATGACTTGACGGTGACTAACCCGCTGCGCATCAAAAA
GGCCATTGAGCTCAAGGCTTGCAATGCCCTGCTTCTCAAGGTGAACCAAATTGGTACCTTGACAGAGTCTATTCA
GGCTGCCAAGGACTCGTATGCCGACGGTTGGGGTGTCATGGTGTCGCACCGATCTGGCGAGACAGAAGATGTGAC
TATTTCGGACATTGTTGTCGGAATTCGGTCCGGCGAGATCAAGACTGGTGCTCCTTGCCGCTCAGAGCGTCTTGC
CAAGCTCAACCAGATTCTGCGCATTGAGGAGGAGTTGGGCGACAAGGCCATCTATGCAGGCCCCAATTTCCGCAA
GGCTGTTAATCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail