Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3240
Gene name
LocationContig_240:5000..6063
Strand+
Gene length (bp)1063
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08597 eIF3_subunit Translation initiation factor eIF3 subunit 3.4E-73 6 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4QTA3|EIF3J_MAGO7 Eukaryotic translation initiation factor 3 subunit J OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HCR1 PE=3 SV=1 1 275 3.0E-68
sp|Q5B136|EIF3J_EMENI Eukaryotic translation initiation factor 3 subunit J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hcr1 PE=3 SV=2 1 275 2.0E-64
sp|Q7S931|EIF3J_NEUCR Eukaryotic translation initiation factor 3 subunit J OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hcr-1 PE=3 SV=1 5 236 1.0E-61
sp|A2RBC7|EIF3J_ASPNC Eukaryotic translation initiation factor 3 subunit J OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hcr1 PE=3 SV=1 3 275 1.0E-57
sp|Q2UMC5|EIF3J_ASPOR Eukaryotic translation initiation factor 3 subunit J OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hcr1 PE=3 SV=1 3 260 2.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4QTA3|EIF3J_MAGO7 Eukaryotic translation initiation factor 3 subunit J OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HCR1 PE=3 SV=1 1 275 3.0E-68
sp|Q5B136|EIF3J_EMENI Eukaryotic translation initiation factor 3 subunit J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hcr1 PE=3 SV=2 1 275 2.0E-64
sp|Q7S931|EIF3J_NEUCR Eukaryotic translation initiation factor 3 subunit J OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hcr-1 PE=3 SV=1 5 236 1.0E-61
sp|A2RBC7|EIF3J_ASPNC Eukaryotic translation initiation factor 3 subunit J OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hcr1 PE=3 SV=1 3 275 1.0E-57
sp|Q2UMC5|EIF3J_ASPOR Eukaryotic translation initiation factor 3 subunit J OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hcr1 PE=3 SV=1 3 260 2.0E-56
sp|A1CE66|EIF3J_ASPCL Eukaryotic translation initiation factor 3 subunit J OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hcr1 PE=3 SV=1 4 275 1.0E-53
sp|Q0CTT3|EIF3J_ASPTN Eukaryotic translation initiation factor 3 subunit J OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hcr1 PE=3 SV=1 3 262 7.0E-52
sp|Q4WND3|EIF3J_ASPFU Eukaryotic translation initiation factor 3 subunit J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hcr1 PE=3 SV=1 40 275 3.0E-49
sp|B0Y762|EIF3J_ASPFC Eukaryotic translation initiation factor 3 subunit J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=hcr1 PE=3 SV=1 40 275 3.0E-49
sp|A1DM75|EIF3J_NEOFI Eukaryotic translation initiation factor 3 subunit J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hcr1 PE=3 SV=1 40 275 4.0E-47
sp|Q6BZW8|EIF3J_YARLI Eukaryotic translation initiation factor 3 subunit J OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HCR1 PE=3 SV=1 40 241 1.0E-15
sp|Q5ACM9|EIF3J_CANAL Eukaryotic translation initiation factor 3 subunit J OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HCR1 PE=3 SV=1 7 235 8.0E-13
sp|Q6BJ82|EIF3J_DEBHA Eukaryotic translation initiation factor 3 subunit J OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HCR1 PE=3 SV=2 7 275 2.0E-12
sp|Q7K550|EIF3J_DROME Eukaryotic translation initiation factor 3 subunit J OS=Drosophila melanogaster GN=Adam PE=1 SV=1 8 275 8.0E-12
sp|B4NX24|EIF3J_DROYA Eukaryotic translation initiation factor 3 subunit J OS=Drosophila yakuba GN=Adam PE=3 SV=1 8 275 1.0E-10
sp|Q8I1G8|EIF3J_DROER Eukaryotic translation initiation factor 3 subunit J OS=Drosophila erecta GN=Adam PE=3 SV=1 8 275 5.0E-10
sp|B4QHU5|EIF3J_DROSI Eukaryotic translation initiation factor 3 subunit J OS=Drosophila simulans GN=Adam PE=3 SV=1 112 275 2.0E-09
sp|B4IMQ8|EIF3J_DROSE Eukaryotic translation initiation factor 3 subunit J OS=Drosophila sechellia GN=Adam PE=3 SV=1 112 275 2.0E-09
sp|A5DI69|EIF3J_PICGU Eukaryotic translation initiation factor 3 subunit J OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HCR1 PE=3 SV=3 7 235 2.0E-09
sp|A5E6K6|EIF3J_LODEL Eukaryotic translation initiation factor 3 subunit J OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HCR1 PE=3 SV=1 7 235 2.0E-09
sp|A7TQ21|EIF3J_VANPO Eukaryotic translation initiation factor 3 subunit J OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=HCR1 PE=3 SV=1 106 275 3.0E-09
sp|Q6CMJ8|EIF3J_KLULA Eukaryotic translation initiation factor 3 subunit J OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HCR1 PE=3 SV=1 109 235 3.0E-09
sp|B4LN42|EIF3J_DROVI Eukaryotic translation initiation factor 3 subunit J OS=Drosophila virilis GN=Adam PE=3 SV=1 112 275 3.0E-08
sp|B3MF39|EIF3J_DROAN Eukaryotic translation initiation factor 3 subunit J OS=Drosophila ananassae GN=Adam PE=3 SV=1 112 275 4.0E-08
sp|B4J4E7|EIF3J_DROGR Eukaryotic translation initiation factor 3 subunit J OS=Drosophila grimshawi GN=Adam PE=3 SV=1 8 270 9.0E-08
sp|B4MP81|EIF3J_DROWI Eukaryotic translation initiation factor 3 subunit J OS=Drosophila willistoni GN=Adam PE=3 SV=1 112 275 1.0E-07
sp|Q54KI0|EIF3J_DICDI Eukaryotic translation initiation factor 3 subunit J OS=Dictyostelium discoideum GN=eif3J PE=3 SV=1 82 244 2.0E-07
sp|Q8I1E5|EIF3J_DROPS Eukaryotic translation initiation factor 3 subunit J OS=Drosophila pseudoobscura pseudoobscura GN=Adam PE=3 SV=1 112 275 1.0E-06
sp|B4GIF2|EIF3J_DROPE Eukaryotic translation initiation factor 3 subunit J OS=Drosophila persimilis GN=Adam PE=3 SV=1 112 275 1.0E-06
sp|Q05775|EIF3J_YEAST Eukaryotic translation initiation factor 3 subunit J OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCR1 PE=1 SV=1 7 235 1.0E-06
sp|Q6FY89|EIF3J_CANGA Eukaryotic translation initiation factor 3 subunit J OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HCR1 PE=3 SV=1 109 235 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0003743 translation initiation factor activity Yes
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0003674 molecular_function No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0045182 translation regulator activity No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3240
MPAPKKWDDEEGDSSTPPSSPPVNAARRRQFGDEEDVDDVLDSWDAAEDSEVEREKQKKADEAKAKAAAEAAANK
KSKTQRVAEHQAERARQRANEDELEEEEETEAHRRERLRRTEQEADLHHAQDLFGSIGISSGRKAPTVGAAVVTD
PKDPTNILNLSDIPLFSPQTKSQFELLRATLAPLFLANSKKAHYSLFLEEFVRDLAKEMSSEQVKKVASALTRLS
NEKMKEEKAADKGGKKTKAAKTKTSLVTTRANTTDVSTYDDDVYGDDDFM*
Coding >OphauG2|3240
ATGCCTGCGCCCAAGAAGTGGGATGACGAGGAAGGCGATTCCAGCACGCCCCCTTCCTCTCCGCCCGTCAACGCC
GCCCGTCGACGACAATTTGGTGACGAAGAAGACGTTGACGATGTGCTCGACTCTTGGGACGCAGCCGAAGACTCG
GAAGTGGAGCGCGAAAAGCAGAAGAAGGCTGACGAAGCCAAGGCCAAGGCTGCTGCCGAGGCTGCTGCCAACAAA
AAGTCCAAGACGCAGCGTGTTGCTGAACATCAAGCCGAACGTGCTCGCCAACGTGCCAATGAAGACGAACTTGAA
GAAGAAGAAGAGACAGAAGCCCATCGCAGAGAGCGACTCCGCCGCACCGAGCAGGAGGCCGATCTTCACCATGCC
CAAGATCTCTTTGGCAGCATTGGCATCAGCTCTGGGCGCAAGGCTCCCACTGTTGGAGCTGCCGTTGTTACTGAC
CCCAAAGATCCTACCAACATTCTCAACCTCAGCGATATCCCCTTGTTTAGTCCTCAAACAAAATCGCAATTCGAG
CTCCTGCGCGCCACTCTGGCGCCTTTGTTTCTCGCCAATTCCAAAAAGGCCCATTACAGCCTCTTTCTCGAAGAG
TTTGTCAGGGATCTTGCCAAGGAAATGTCGAGCGAGCAGGTCAAAAAAGTTGCCAGCGCCCTTACCCGCCTCAGC
AATGAAAAGATGAAGGAAGAAAAAGCGGCCGACAAGGGAGGCAAGAAGACAAAGGCAGCCAAGACGAAGACTTCG
CTTGTCACCACGCGTGCCAACACGACTGACGTTTCTACATATGACGATGATGTCTATGGCGATGATGATTTCATG
TGA
Transcript >OphauG2|3240
ATGCCTGCGCCCAAGAAGTGGGATGACGAGGAAGGCGATTCCAGCACGCCCCCTTCCTCTCCGCCCGTCAACGCC
GCCCGTCGACGACAATTTGGTGACGAAGAAGACGTTGACGATGTGCTCGACTCTTGGGACGCAGCCGAAGACTCG
GAAGTGGAGCGCGAAAAGCAGAAGAAGGCTGACGAAGCCAAGGCCAAGGCTGCTGCCGAGGCTGCTGCCAACAAA
AAGTCCAAGACGCAGCGTGTTGCTGAACATCAAGCCGAACGTGCTCGCCAACGTGCCAATGAAGACGAACTTGAA
GAAGAAGAAGAGACAGAAGCCCATCGCAGAGAGCGACTCCGCCGCACCGAGCAGGAGGCCGATCTTCACCATGCC
CAAGATCTCTTTGGCAGCATTGGCATCAGCTCTGGGCGCAAGGCTCCCACTGTTGGAGCTGCCGTTGTTACTGAC
CCCAAAGATCCTACCAACATTCTCAACCTCAGCGATATCCCCTTGTTTAGTCCTCAAACAAAATCGCAATTCGAG
CTCCTGCGCGCCACTCTGGCGCCTTTGTTTCTCGCCAATTCCAAAAAGGCCCATTACAGCCTCTTTCTCGAAGAG
TTTGTCAGGGATCTTGCCAAGGAAATGTCGAGCGAGCAGGTCAAAAAAGTTGCCAGCGCCCTTACCCGCCTCAGC
AATGAAAAGATGAAGGAAGAAAAAGCGGCCGACAAGGGAGGCAAGAAGACAAAGGCAGCCAAGACGAAGACTTCG
CTTGTCACCACGCGTGCCAACACGACTGACGTTTCTACATATGACGATGATGTCTATGGCGATGATGATTTCATG
TGA
Gene >OphauG2|3240
ATGCCTGCGCCCAAGAAGTGGGGTGAGTCTTATTTCTTCAGGCTTCTCCATGTCCCTAGTTGCCAATCATTACCT
TTCGCCCTTGAAGCCCCCATTGGAAATCATCATCTGGTACTGACCAAGACCTTCACGACAGATGACGAGGAAGGC
GATTCCAGCACGCCCCCTTCCTCTCCGCCCGTCAACGCCGCCCGTCGACGACAATTTGGTGACGAAGAAGACGTT
GACGATGTGAGTCGAGTCAGCCACCACGATCCAGAAGTCCCCTCATACTCATGCTTTGATGCAGGTGCTCGACTC
TTGGGACGCAGCCGAAGACTCGGAAGTGGAGCGCGAAAAGCAGAAGAAGGCTGACGAAGCCAAGGCCAAGGCTGC
TGCCGAGGCTGCTGCCAACAAAAAGTCCAAGACGCAGCGTGTTGCTGAACATCAAGCCGAACGTGCTCGCCAACG
TGCCAATGAAGACGAACTTGAAGAAGAAGAAGAGACAGAAGCCCATCGCAGAGAGCGACTCCGCCGCACCGAGCA
GGAGGCCGATCTTCACCATGCCCAAGATCTCTTTGGCAGCATTGGCATCAGCTCTGGGCGCAAGGCTCCCACTGT
TGGAGCTGCCGTTGTTACTGACCCCAAAGATCCTACCAACATTCTCAACCTCAGCGATATCCCCTTGTTTAGTCC
TCAAACAAAATCGCAATTCGAGCTCCTGCGCGCCACTCTGGCGCCTTTGTTTCTCGCCAATTCCAAAAAGGCCCA
TTACAGCCTCTTTCTCGAAGAGTTTGTCAGGGATCTTGCCAAGGAAATGTCGAGCGAGCAGGTCAAAAAAGTTGC
CAGCGCCCTTACCCGCCTCAGCAATGAAAAGATGAAGGAAGAAAAAGCGGCCGACAAGGGAGGCAAGAAGACAAA
GGCAGCCAAGACGAAGACTTCGCTTGTCACCACGCGTGCCAACACGACTGACGTTTCTACATATGACGATGATGT
CTATGGCGAGTACGTTGTTGGCGCACTATCATCGGGAAAAGTGCTCGCAGAGACTAACACTTGCATTTACAGTGA
TGATTTCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail