Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3226
Gene name
LocationContig_24:15678..16974
Strand+
Gene length (bp)1296
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18972 Wheel Cns1/TTC4 Wheel domain 8.3E-32 311 423

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13754|CNS1_SCHPO Hsp70/Hsp90 co-chaperone cns1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cns1 PE=3 SV=1 32 431 5.0E-53
sp|P33313|CNS1_YEAST Hsp70/Hsp90 co-chaperone CNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNS1 PE=1 SV=1 35 429 3.0E-47
sp|O95801|TTC4_HUMAN Tetratricopeptide repeat protein 4 OS=Homo sapiens GN=TTC4 PE=1 SV=3 38 395 1.0E-14
sp|Q8R3H9|TTC4_MOUSE Tetratricopeptide repeat protein 4 OS=Mus musculus GN=Ttc4 PE=1 SV=1 38 379 2.0E-14
sp|Q5EA11|TTC4_BOVIN Tetratricopeptide repeat protein 4 OS=Bos taurus GN=TTC4 PE=2 SV=2 43 379 7.0E-14

GO

GO Term Description Terminal node
GO:0051879 Hsp90 protein binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0031072 heat shock protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup645
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3226 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3867
Ophiocordyceps camponoti-floridani Ophcf2|04141
Ophiocordyceps camponoti-rufipedis Ophun1|1210
Ophiocordyceps kimflemingae Ophio5|3238
Ophiocordyceps subramaniannii Hirsu2|10511
Ophiocordyceps subramaniannii Hirsu2|4616

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3226
MASKMHLGSSSATTSTTTTNSKPLPNPCPLPTTTRTVDEVWTELNACPLFMTELQENDDIAALQALSYEGTRLDV
ALDARERGNECFGVRGYVDAREFYSKGVSVLSKPKNEADWAGDEGEGRGKEQGDEEQEEEVLETLLVNRAACHLA
LQNYRAAWLDCAAALRRNPRNIKALYRSARALLAVERVDEAQDACLRGIEAARHHLQQQQDGQQQKQDRGQQQKQ
EAESRQDEAKIQSQLVALESLAAQISARTAALDSKRRAASARRALDARRARLVAAALAARNISTRRTADRPLHDA
VDAAIALVPNPDDAHSALAFPTLLLYPLHLESDFIRAFVESDTLADHLAYILPPPWDNEASSCPKYTPESVSCYL
ETHNGGLLKLGKRVPLLKALSTGSVEIIDQLLRIFIVPTSEADAWVSKHKAQRSSN*
Coding >OphauG2|3226
ATGGCGTCCAAGATGCATCTTGGATCCTCAAGCGCGACGACAAGCACCACGACGACCAACTCTAAGCCGCTACCC
AATCCATGCCCACTACCCACGACCACCAGGACTGTCGACGAGGTCTGGACCGAACTAAACGCCTGCCCGCTCTTC
ATGACTGAGCTCCAAGAAAACGACGACATAGCAGCGCTCCAGGCTCTAAGCTACGAGGGGACACGACTCGATGTT
GCGCTTGATGCGCGCGAGCGTGGCAATGAGTGTTTTGGTGTGAGGGGATATGTCGATGCGCGCGAGTTTTATTCC
AAGGGCGTTTCAGTCTTGTCGAAACCCAAGAATGAAGCAGATTGGGCTGGAGACGAAGGAGAGGGGAGGGGAAAA
GAGCAAGGGGACGAGGAACAGGAGGAAGAGGTCTTGGAAACGTTGCTCGTCAATCGCGCGGCATGTCACCTGGCA
CTACAAAACTACCGCGCGGCGTGGCTAGACTGCGCTGCTGCGTTGAGACGCAATCCACGAAATATAAAGGCGCTA
TATCGCAGCGCACGCGCCTTGTTGGCTGTGGAGCGCGTCGACGAGGCGCAGGATGCGTGTCTGCGCGGCATTGAG
GCTGCGCGCCACCACCTTCAACAGCAACAAGATGGGCAGCAACAGAAGCAAGATCGAGGTCAGCAGCAGAAGCAA
GAAGCAGAGAGCAGGCAGGACGAGGCCAAGATTCAGAGCCAACTCGTTGCCCTCGAATCCCTCGCCGCCCAAATC
TCTGCCCGCACCGCTGCCCTCGACTCCAAGCGCCGCGCCGCCTCTGCCCGTCGCGCCCTCGACGCCCGCCGCGCC
CGCCTCGTCGCCGCTGCCCTGGCTGCTCGCAACATATCCACTCGCCGCACTGCTGATCGGCCCCTTCATGATGCC
GTCGACGCCGCCATTGCCCTCGTACCGAACCCAGACGATGCGCACAGCGCCCTTGCTTTCCCAACTCTGCTTCTC
TACCCGCTGCACCTAGAGTCCGACTTTATCCGCGCCTTTGTCGAGTCGGATACCCTCGCAGACCATCTCGCCTAC
ATTTTGCCCCCGCCATGGGACAATGAGGCGTCGAGCTGTCCCAAATACACTCCCGAAAGCGTATCCTGCTACCTC
GAGACGCACAACGGCGGCCTGCTCAAGCTGGGCAAGCGCGTACCCTTGCTCAAGGCCCTGAGCACAGGTAGCGTG
GAAATCATTGACCAGCTACTACGCATCTTTATCGTGCCCACGTCCGAAGCTGATGCCTGGGTGTCCAAACACAAA
GCCCAGCGGTCAAGCAATTAA
Transcript >OphauG2|3226
ATGGCGTCCAAGATGCATCTTGGATCCTCAAGCGCGACGACAAGCACCACGACGACCAACTCTAAGCCGCTACCC
AATCCATGCCCACTACCCACGACCACCAGGACTGTCGACGAGGTCTGGACCGAACTAAACGCCTGCCCGCTCTTC
ATGACTGAGCTCCAAGAAAACGACGACATAGCAGCGCTCCAGGCTCTAAGCTACGAGGGGACACGACTCGATGTT
GCGCTTGATGCGCGCGAGCGTGGCAATGAGTGTTTTGGTGTGAGGGGATATGTCGATGCGCGCGAGTTTTATTCC
AAGGGCGTTTCAGTCTTGTCGAAACCCAAGAATGAAGCAGATTGGGCTGGAGACGAAGGAGAGGGGAGGGGAAAA
GAGCAAGGGGACGAGGAACAGGAGGAAGAGGTCTTGGAAACGTTGCTCGTCAATCGCGCGGCATGTCACCTGGCA
CTACAAAACTACCGCGCGGCGTGGCTAGACTGCGCTGCTGCGTTGAGACGCAATCCACGAAATATAAAGGCGCTA
TATCGCAGCGCACGCGCCTTGTTGGCTGTGGAGCGCGTCGACGAGGCGCAGGATGCGTGTCTGCGCGGCATTGAG
GCTGCGCGCCACCACCTTCAACAGCAACAAGATGGGCAGCAACAGAAGCAAGATCGAGGTCAGCAGCAGAAGCAA
GAAGCAGAGAGCAGGCAGGACGAGGCCAAGATTCAGAGCCAACTCGTTGCCCTCGAATCCCTCGCCGCCCAAATC
TCTGCCCGCACCGCTGCCCTCGACTCCAAGCGCCGCGCCGCCTCTGCCCGTCGCGCCCTCGACGCCCGCCGCGCC
CGCCTCGTCGCCGCTGCCCTGGCTGCTCGCAACATATCCACTCGCCGCACTGCTGATCGGCCCCTTCATGATGCC
GTCGACGCCGCCATTGCCCTCGTACCGAACCCAGACGATGCGCACAGCGCCCTTGCTTTCCCAACTCTGCTTCTC
TACCCGCTGCACCTAGAGTCCGACTTTATCCGCGCCTTTGTCGAGTCGGATACCCTCGCAGACCATCTCGCCTAC
ATTTTGCCCCCGCCATGGGACAATGAGGCGTCGAGCTGTCCCAAATACACTCCCGAAAGCGTATCCTGCTACCTC
GAGACGCACAACGGCGGCCTGCTCAAGCTGGGCAAGCGCGTACCCTTGCTCAAGGCCCTGAGCACAGGTAGCGTG
GAAATCATTGACCAGCTACTACGCATCTTTATCGTGCCCACGTCCGAAGCTGATGCCTGGGTGTCCAAACACAAA
GCCCAGCGGTCAAGCAATTAA
Gene >OphauG2|3226
ATGGCGTCCAAGATGCATCTTGGATCCTCAAGCGCGACGACAAGCACCACGACGACCAACTCTAAGCCGCTACCC
AATCCATGCCCACTACCCACGACCACCAGGACTGTCGACGAGGTCTGGACCGAACTAAACGCCTGCCCGCTCTTC
ATGACTGAGCTCCAAGAAAACGACGACATAGCAGCGCTCCAGGCTCTAAGCTACGAGGGGACACGACTCGATGTT
GCGCTTGATGCGCGCGAGCGTGGCAATGAGTGTTTTGGTGTGAGGGGATATGTCGATGCGCGCGAGTTTTATTCC
AAGGGCGTTTCAGTCTTGTCGAAACCCAAGAATGAAGCAGATTGGGCTGGAGACGAAGGAGAGGGGAGGGGAAAA
GAGCAAGGGGACGAGGAACAGGAGGAAGAGGTCTTGGAAACGTTGCTCGTCAATCGCGCGGCATGTCACCTGGCA
CTACAAAACTACCGCGCGGCGTGGCTAGACTGCGCTGCTGCGTTGAGACGCAATCCACGAAATATAAAGGCGCTA
TATCGCAGCGCACGCGCCTTGTTGGCTGTGGAGCGCGTCGACGAGGCGCAGGATGCGTGTCTGCGCGGCATTGAG
GCTGCGCGCCACCACCTTCAACAGCAACAAGATGGGCAGCAACAGAAGCAAGATCGAGGTCAGCAGCAGAAGCAA
GAAGCAGAGAGCAGGCAGGACGAGGCCAAGATTCAGAGCCAACTCGTTGCCCTCGAATCCCTCGCCGCCCAAATC
TCTGCCCGCACCGCTGCCCTCGACTCCAAGCGCCGCGCCGCCTCTGCCCGTCGCGCCCTCGACGCCCGCCGCGCC
CGCCTCGTCGCCGCTGCCCTGGCTGCTCGCAACATATCCACTCGCCGCACTGCTGATCGGCCCCTTCATGATGCC
GTCGACGCCGCCATTGCCCTCGTACCGAACCCAGACGATGCGCACAGCGCCCTTGCTTTCCCAACTCTGCTTCTC
TACCCGCTGCACCTAGAGTCCGACTTTATCCGCGCCTTTGTCGAGTCGGATACCCTCGCAGACCATCTCGCCTAC
ATTTTGCCCCCGCCATGGGACAATGAGGCGTCGAGCTGTCCCAAATACACTCCCGAAAGCGTATCCTGCTACCTC
GAGACGCACAACGGCGGCCTGCTCAAGCTGGGCAAGCGCGTACCCTTGCTCAAGGCCCTGAGCACAGGTAGCGTG
GAAATCATTGACCAGCTACTACGCATCTTTATCGTGCCCACGTCCGAAGCTGATGCCTGGGTGTCCAAACACAAA
GCCCAGCGGTCAAGCAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail