Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3224
Gene name
LocationContig_24:9903..10569
Strand+
Gene length (bp)666
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01230 HIT HIT domain 1.6E-22 17 113
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 6.4E-06 35 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49776|APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aph1 PE=1 SV=2 9 169 3.0E-39
sp|Q86KK2|FHIT_DICDI Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1 10 177 5.0E-33
sp|P49789|FHIT_HUMAN Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3 10 137 5.0E-30
sp|P49775|HNT2_YEAST Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT2 PE=1 SV=2 11 178 7.0E-30
sp|C8Z5L6|HNT2_YEAS8 Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HNT2 PE=3 SV=2 11 178 7.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49776|APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aph1 PE=1 SV=2 9 169 3.0E-39
sp|Q86KK2|FHIT_DICDI Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1 10 177 5.0E-33
sp|P49789|FHIT_HUMAN Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3 10 137 5.0E-30
sp|P49775|HNT2_YEAST Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT2 PE=1 SV=2 11 178 7.0E-30
sp|C8Z5L6|HNT2_YEAS8 Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HNT2 PE=3 SV=2 11 178 7.0E-30
sp|A6ZYQ3|HNT2_YEAS7 Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain YJM789) GN=HNT2 PE=3 SV=2 11 178 7.0E-30
sp|B5VGI4|HNT2_YEAS6 Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=HNT2 PE=3 SV=2 11 178 7.0E-30
sp|C7GQV5|HNT2_YEAS2 Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain JAY291) GN=HNT2 PE=3 SV=2 11 178 7.0E-30
sp|B3LFZ1|HNT2_YEAS1 Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HNT2 PE=3 SV=2 11 178 7.0E-30
sp|Q1KZG4|FHIT_BOVIN Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1 10 137 2.0E-29
sp|O89106|FHIT_MOUSE Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=1 SV=3 10 137 6.0E-29
sp|Q9JIX3|FHIT_RAT Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1 10 137 1.0E-28
sp|O76463|NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1 13 175 4.0E-28
sp|O76464|NFT1_DROME Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster GN=NitFhit PE=1 SV=1 22 125 1.0E-19
sp|P9WMK9|AP4A_MYCTU AP-4-A phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2613c PE=1 SV=1 28 118 9.0E-12
sp|P9WMK8|AP4A_MYCTO AP-4-A phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2688 PE=3 SV=1 28 118 9.0E-12
sp|Q58276|Y866_METJA Uncharacterized HIT-like protein MJ0866 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0866 PE=3 SV=2 17 117 3.0E-10
sp|Q04344|HNT1_YEAST Hit family protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT1 PE=1 SV=2 17 118 1.0E-08
sp|P9WML1|YHI2_MYCTU Uncharacterized HIT-like protein Rv1262c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1262c PE=3 SV=1 30 116 1.0E-08
sp|P9WML0|YHI2_MYCTO Uncharacterized HIT-like protein MT1300 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1300 PE=3 SV=1 30 116 1.0E-08
sp|O94586|HNT1_SCHPO Hit family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt1 PE=3 SV=1 26 118 2.0E-08
sp|P32084|Y1390_SYNE7 Uncharacterized HIT-like protein Synpcc7942_1390 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1390 PE=3 SV=1 17 110 2.0E-07
sp|P73481|YHIT_SYNY3 Uncharacterized HIT-like protein slr1234 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1234 PE=3 SV=1 17 110 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3224
MGSVARARESIWFGPYEVASQVFITTPLSFALVNLKPLLPGHVLVCPRRPLARLLDLTPAEASDLMTTVQQTQRV
LAKAYLAGKGGDFTVAVQDGPLAGQTVPHLHVHVIPRQGEDGGDEIYGRLAGEEGNVGGALWDVQRPVPGGGMAA
IEDADRRARGPEEMQAEAERYRVLLKEL*
Coding >OphauG2|3224
ATGGGAAGCGTGGCGAGGGCACGCGAGAGCATCTGGTTTGGGCCGTACGAGGTGGCGTCACAGGTTTTCATCACG
ACGCCCCTCTCGTTTGCGCTCGTCAATCTCAAGCCTCTGCTCCCAGGCCACGTGCTCGTCTGTCCCCGCCGACCA
CTGGCGCGCCTCCTTGATCTCACGCCCGCCGAGGCGAGCGACTTGATGACGACGGTGCAACAGACGCAGCGCGTG
CTGGCCAAGGCATACCTGGCGGGCAAGGGCGGCGACTTTACAGTGGCGGTGCAGGACGGGCCTCTGGCCGGGCAG
ACGGTGCCGCATCTTCATGTTCATGTCATTCCGCGACAAGGGGAGGATGGCGGCGATGAGATTTACGGCCGATTG
GCGGGGGAGGAGGGAAATGTTGGGGGGGCACTGTGGGATGTGCAGAGGCCGGTGCCGGGGGGAGGCATGGCAGCT
ATTGAGGATGCGGATAGACGCGCGAGGGGGCCAGAGGAAATGCAGGCCGAGGCGGAGAGGTATCGGGTGCTGCTC
AAGGAGCTGTAG
Transcript >OphauG2|3224
ATGGGAAGCGTGGCGAGGGCACGCGAGAGCATCTGGTTTGGGCCGTACGAGGTGGCGTCACAGGTTTTCATCACG
ACGCCCCTCTCGTTTGCGCTCGTCAATCTCAAGCCTCTGCTCCCAGGCCACGTGCTCGTCTGTCCCCGCCGACCA
CTGGCGCGCCTCCTTGATCTCACGCCCGCCGAGGCGAGCGACTTGATGACGACGGTGCAACAGACGCAGCGCGTG
CTGGCCAAGGCATACCTGGCGGGCAAGGGCGGCGACTTTACAGTGGCGGTGCAGGACGGGCCTCTGGCCGGGCAG
ACGGTGCCGCATCTTCATGTTCATGTCATTCCGCGACAAGGGGAGGATGGCGGCGATGAGATTTACGGCCGATTG
GCGGGGGAGGAGGGAAATGTTGGGGGGGCACTGTGGGATGTGCAGAGGCCGGTGCCGGGGGGAGGCATGGCAGCT
ATTGAGGATGCGGATAGACGCGCGAGGGGGCCAGAGGAAATGCAGGCCGAGGCGGAGAGGTATCGGGTGCTGCTC
AAGGAGCTGTAG
Gene >OphauG2|3224
ATGGGAAGCGTGGCGAGGGCACGCGAGAGCATCTGGTTTGGGCCGTACGAGGTGGCGTCACAGGTGACTTGTCTT
TGCCCCCAGACGAATAATCATTGCTGGCAGAGGATGAGAAGAGATCAACTAGCAATCAACTAGCACAGCACAAGA
GGAGCTAGCCAAGGGAAAAAAGGCCAACTGATGCCCCCGCAGGTTTTCATCACGACGCCCCTCTCGTTTGCGCTC
GTCAATCTCAAGCCTCTGCTCCCAGGCCACGTGCTCGTCTGTCCCCGCCGACCACTGGCGCGCCTCCTTGATCTC
ACGCCCGCCGAGGCGAGCGACTTGATGACGACGGTGCAACAGACGCAGCGCGTGCTGGCCAAGGCATACCTGGCG
GGCAAGGGCGGCGACTTTACAGTGGCGGTGCAGGACGGGCCTCTGGCCGGGCAGACGGTGCCGCATCTTCATGTT
CATGTCATTCCGCGACAAGGGGAGGATGGCGGCGATGAGATTTACGGCCGATTGGCGGGGGAGGAGGGAAATGTT
GGGGGGGCACTGTGGGATGTGCAGAGGCCGGTGCCGGGGGGAGGCATGGCAGCTATTGAGGATGCGGATAGACGC
GCGAGGGGGCCAGAGGAAATGCAGGCCGAGGCGGAGAGGTATCGGGTGCTGCTCAAGGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail