Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3205
Gene name
LocationContig_238:5987..7455
Strand+
Gene length (bp)1468
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09995 MPAB_Lcp_cat ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain 1.1E-06 146 283

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3205
MSQLLFPSWTHIFSVLLLPYIALCSLLRFRRLRSLQAKYHFPDRASLSRMTGTEAHEIHHQCSAYEFPFAYDYGL
RIAIFKTYALENIGGLLAASSDLMSTQNVGKRYEDTEIIFSSFFQWPPSSTALHDFVARMNYLHQPYIKSGRILN
EDMLYVLYLSLVEPMNHQRLYEWRSLTDMEVAAGATFWYYIGEMMGIDYQSELGKDNWNDGIDFLDDLEAWSFKY
EDLHLKRLPEVHKLGVNLIDFMLSVYPRVSHPVVYQAVLLLLGERVRHALSLPEPSLAMSAIFYSSLLVRRFVLR
FLALPRLFPVQNLSDLDVKTGKVHHQRYLKEPWYVAPTFWARWGPMALCSRILGIMVPGQGGARMKPDGFYVEDL
GPHRTVGNGAEQMAVMRERIKRVAERVAHESPFATKS*
Coding >OphauG2|3205
ATGTCTCAGCTTCTCTTTCCTTCCTGGACCCATATTTTCTCTGTTCTCTTGCTTCCCTACATTGCTCTGTGCTCA
TTGCTGCGCTTCCGGCGACTACGCAGCCTCCAAGCCAAATACCATTTCCCAGATCGAGCCTCGCTGTCACGAATG
ACGGGGACCGAAGCTCATGAAATTCATCATCAGTGTTCCGCGTATGAGTTTCCGTTTGCCTACGACTATGGCTTG
CGGATTGCCATCTTCAAGACGTATGCTCTGGAGAACATCGGGGGTCTCCTCGCTGCCTCAAGCGACCTGATGAGC
ACGCAAAACGTGGGGAAGAGATACGAAGACACCGAAATCATTTTTTCCAGCTTTTTCCAATGGCCTCCTTCGTCG
ACGGCGCTCCACGACTTTGTTGCCCGCATGAACTACCTACACCAGCCGTACATCAAGTCTGGAAGAATACTCAAC
GAGGACATGCTCTATGTTCTCTACCTTTCGCTCGTGGAGCCCATGAATCACCAGCGCTTGTATGAGTGGAGGTCC
CTGACCGACATGGAGGTGGCAGCAGGTGCAACTTTTTGGTACTACATAGGCGAAATGATGGGCATCGACTACCAG
AGTGAGCTGGGCAAGGACAACTGGAACGATGGCATCGACTTTCTCGACGACCTGGAAGCATGGAGCTTCAAGTAC
GAGGACCTACATTTGAAGCGGCTACCAGAGGTGCACAAGCTGGGCGTCAATCTCATCGACTTTATGTTGTCGGTA
TATCCCAGAGTGTCGCATCCAGTTGTGTACCAAGCGGTGCTGCTTCTGTTGGGCGAGAGGGTGCGCCATGCGCTC
TCATTACCGGAACCAAGCTTGGCAATGTCTGCCATCTTCTACTCGTCACTCCTGGTTCGCAGATTTGTCCTCCGC
TTCTTGGCACTACCTCGCCTCTTCCCGGTGCAAAATCTTAGCGATTTAGATGTCAAAACGGGCAAAGTCCACCAT
CAACGATATCTCAAGGAGCCGTGGTACGTGGCCCCTACATTTTGGGCTCGCTGGGGCCCCATGGCTCTGTGTTCG
CGGATACTAGGCATCATGGTGCCTGGGCAAGGGGGCGCAAGGATGAAGCCCGACGGCTTTTACGTTGAAGATCTT
GGACCACACCGGACAGTGGGCAATGGAGCTGAGCAAATGGCGGTGATGCGTGAGCGGATCAAGAGGGTTGCCGAG
CGAGTGGCCCATGAGAGCCCGTTTGCCACGAAGAGTTGA
Transcript >OphauG2|3205
ATGTCTCAGCTTCTCTTTCCTTCCTGGACCCATATTTTCTCTGTTCTCTTGCTTCCCTACATTGCTCTGTGCTCA
TTGCTGCGCTTCCGGCGACTACGCAGCCTCCAAGCCAAATACCATTTCCCAGATCGAGCCTCGCTGTCACGAATG
ACGGGGACCGAAGCTCATGAAATTCATCATCAGTGTTCCGCGTATGAGTTTCCGTTTGCCTACGACTATGGCTTG
CGGATTGCCATCTTCAAGACGTATGCTCTGGAGAACATCGGGGGTCTCCTCGCTGCCTCAAGCGACCTGATGAGC
ACGCAAAACGTGGGGAAGAGATACGAAGACACCGAAATCATTTTTTCCAGCTTTTTCCAATGGCCTCCTTCGTCG
ACGGCGCTCCACGACTTTGTTGCCCGCATGAACTACCTACACCAGCCGTACATCAAGTCTGGAAGAATACTCAAC
GAGGACATGCTCTATGTTCTCTACCTTTCGCTCGTGGAGCCCATGAATCACCAGCGCTTGTATGAGTGGAGGTCC
CTGACCGACATGGAGGTGGCAGCAGGTGCAACTTTTTGGTACTACATAGGCGAAATGATGGGCATCGACTACCAG
AGTGAGCTGGGCAAGGACAACTGGAACGATGGCATCGACTTTCTCGACGACCTGGAAGCATGGAGCTTCAAGTAC
GAGGACCTACATTTGAAGCGGCTACCAGAGGTGCACAAGCTGGGCGTCAATCTCATCGACTTTATGTTGTCGGTA
TATCCCAGAGTGTCGCATCCAGTTGTGTACCAAGCGGTGCTGCTTCTGTTGGGCGAGAGGGTGCGCCATGCGCTC
TCATTACCGGAACCAAGCTTGGCAATGTCTGCCATCTTCTACTCGTCACTCCTGGTTCGCAGATTTGTCCTCCGC
TTCTTGGCACTACCTCGCCTCTTCCCGGTGCAAAATCTTAGCGATTTAGATGTCAAAACGGGCAAAGTCCACCAT
CAACGATATCTCAAGGAGCCGTGGTACGTGGCCCCTACATTTTGGGCTCGCTGGGGCCCCATGGCTCTGTGTTCG
CGGATACTAGGCATCATGGTGCCTGGGCAAGGGGGCGCAAGGATGAAGCCCGACGGCTTTTACGTTGAAGATCTT
GGACCACACCGGACAGTGGGCAATGGAGCTGAGCAAATGGCGGTGATGCGTGAGCGGATCAAGAGGGTTGCCGAG
CGAGTGGCCCATGAGAGCCCGTTTGCCACGAAGAGTTGA
Gene >OphauG2|3205
ATGTCTCAGCTTCTCTTTCCTTCCTGGACCCATATTTTCTCTGTTCTCTTGCTTCCCTACATTGCTCTGTGCTCA
TTGCTGCGCTTCCGGCGACTACGCAGCCTCCAAGCCAAATACCATTTCCCAGATCGAGCCTCGCTGTCACGAATG
ACGGGGACCGAAGCTCATGAAATTCATCATCAGTGTTCCGCGTATGAGTTTCCGTTTGCCTACGACTATGGCTTG
CGGATTGCCATCTTCAAGGTGGGCAACCATGGCATTCTTGGGCACGCTGTCGACGTAGCGTGCAAACTAAAGGGA
GAATGTTACAGACGTATGCTCTGGAGAACATCGGGGGTCTCCTCGCTGCCTCAAGCGACCTGATGAGCACGCAAA
ACGTGGGGAAGAGGTGGTGTCTTTTTGAGTGTAAACAGGTCAACATGTCTTGCTGATGCAAAGCAGATACGAAGA
CACCGAAATCATTTTTTCCAGGTAAGCTCTATACTCGGTATAGCGTGGCCCAGTCGCTTAAGCATGTGTCGGGCA
GCTTTTTCCAATGGCCTCCTTCGTCGACGGCGCTCCACGACTTTGTTGCCCGCATGAACTACCTACACCAGCCGT
ACATCAAGTCTGGAAGAATACTCAACGAGGACATGCTCTATGTTCTCTACCTTTCGCTCGTGGAGCCCATGAATC
ACCAGCGCTTGTATGAGTGGAGGTCCCTGACCGACATGGAGGTGGCAGCAGGTGCAACTTTTTGGTACTACATAG
GCGAAATGATGGGCATCGACTACCAGAGTGAGCTGGGCAAGGACAACTGGAACGATGGCATCGACTTTCTCGACG
ACCTGGAAGCATGGAGCTTCAAGTACGAGGACCTACATTTGAAGCGGCTACCAGAGGTGCACAAGCTGGGCGTCA
ATCTCATCGACTTTATGTTGTCGGTATATCCCAGAGTGTCGCATCCAGTTGTGTACCAAGCGGTGCTGCTTCTGT
TGGGCGAGAGGGTGCGCCATGCGCTCTCGTAAGTCTTATACAAGCCTACCAGCCAACAAGACACGCTGACAGGCA
AATAAGATTACCGGAACCAAGCTTGGCAATGTCTGCCATCTTCTACTCGTCACTCCTGGTTCGCAGATTTGTCCT
CCGCTTCTTGGCACTACCTCGCCTCTTCCCGGTGCAAAATCTTAGCGATTTAGATGTCAAAACGGGCAAAGTCCA
CCATCAACGATATCTCAAGGAGCCGTGGTACGTGGCCCCTACATTTTGGGCTCGCTGGGGCCCCATGGCTCTGTG
TTCGCGGATACTAGGCATCATGGTGCCTGGGCAAGGGGGCGCAAGGATGAAGCCCGACGGCTTTTACGTTGAAGA
TCTTGGACCACACCGGACAGTGGGCAATGGAGCTGAGCAAATGGCGGTGATGCGTGAGCGGATCAAGAGGGTTGC
CGAGCGAGTGGCCCATGAGAGCCCGTTTGCCACGAAGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail