Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3196
Gene name
LocationContig_237:724..1207
Strand+
Gene length (bp)483
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999782

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3196 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|548
Ophiocordyceps subramaniannii Hirsu2|7155

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3196
MYTLTALVLLAAWAAAIPMRPPFLRETSPGAIIMDQAYQGISRLGPAGGLRADKMFPKGGGMPFKSLPGGLPELA
HPPSKFPAPPGKQSVGVGSAPGTPLGPRKKTGVVENLPPWSADGLEPHFPSPPPSPHITSSLTRPLDFPLREKPM
HSKYLEGKYP*
Coding >OphauG2|3196
ATGTACACCTTGACCGCTCTTGTTCTCTTGGCCGCCTGGGCCGCCGCCATACCCATGAGGCCACCGTTTCTGCGT
GAGACATCGCCAGGAGCCATCATCATGGACCAAGCATATCAGGGTATCTCTCGGCTCGGACCAGCGGGAGGACTC
CGAGCAGACAAGATGTTTCCCAAGGGCGGCGGCATGCCTTTTAAAAGCCTTCCCGGAGGGCTTCCTGAACTCGCC
CACCCGCCGTCCAAGTTCCCGGCCCCGCCTGGAAAGCAAAGCGTTGGCGTTGGAAGCGCGCCCGGAACCCCCCTA
GGGCCTAGAAAGAAGACGGGCGTCGTTGAGAATCTTCCGCCATGGTCCGCCGACGGCCTCGAACCCCACTTTCCT
TCGCCTCCACCTTCACCTCACATCACCAGTTCCTTGACACGGCCGCTCGATTTCCCGCTTAGAGAGAAGCCTATG
CATTCAAAATACCTCGAGGGCAAATATCCGTAA
Transcript >OphauG2|3196
ATGTACACCTTGACCGCTCTTGTTCTCTTGGCCGCCTGGGCCGCCGCCATACCCATGAGGCCACCGTTTCTGCGT
GAGACATCGCCAGGAGCCATCATCATGGACCAAGCATATCAGGGTATCTCTCGGCTCGGACCAGCGGGAGGACTC
CGAGCAGACAAGATGTTTCCCAAGGGCGGCGGCATGCCTTTTAAAAGCCTTCCCGGAGGGCTTCCTGAACTCGCC
CACCCGCCGTCCAAGTTCCCGGCCCCGCCTGGAAAGCAAAGCGTTGGCGTTGGAAGCGCGCCCGGAACCCCCCTA
GGGCCTAGAAAGAAGACGGGCGTCGTTGAGAATCTTCCGCCATGGTCCGCCGACGGCCTCGAACCCCACTTTCCT
TCGCCTCCACCTTCACCTCACATCACCAGTTCCTTGACACGGCCGCTCGATTTCCCGCTTAGAGAGAAGCCTATG
CATTCAAAATACCTCGAGGGCAAATATCCGTAA
Gene >OphauG2|3196
ATGTACACCTTGACCGCTCTTGTTCTCTTGGCCGCCTGGGCCGCCGCCATACCCATGAGGCCACCGTTTCTGCGT
GAGACATCGCCAGGAGCCATCATCATGGACCAAGCATATCAGGGTATCTCTCGGCTCGGACCAGCGGGAGGACTC
CGAGCAGACAAGATGTTTCCCAAGGGCGGCGGCATGCCTTTTAAAAGCCTTCCCGGAGGGCTTCCTGAACTCGCC
CACCCGCCGTCCAAGTTCCCGGCCCCGCCTGGAAAGCAAAGCGTTGGCGTTGGAAGCGCGCCCGGAACCCCCCTA
GGGCCTAGAAAGAAGACGGGCGTCGTTGAGAATCTTCCGCCATGGTCCGCCGACGGCCTCGAACCCCACTTTCCT
TCGCCTCCACCTTCACCTCACATCACCAGTTCCTTGACACGGCCGCTCGATTTCCCGCTTAGAGAGAAGCCTATG
CATTCAAAATACCTCGAGGGCAAATATCCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail