Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3195
Gene name
LocationContig_236:19617..22063
Strand-
Gene length (bp)2446
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.9E-14 101 169
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.1E-14 215 285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 95 305 2.0E-57
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 93 295 8.0E-29
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 94 301 5.0E-27
sp|Q9D0E1|HNRPM_MOUSE Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus GN=Hnrnpm PE=1 SV=3 94 301 8.0E-27
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 25 288 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 95 305 2.0E-57
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 93 295 8.0E-29
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 94 301 5.0E-27
sp|Q9D0E1|HNRPM_MOUSE Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus GN=Hnrnpm PE=1 SV=3 94 301 8.0E-27
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 25 288 1.0E-26
sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 94 301 3.0E-26
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 100 291 7.0E-26
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 100 291 2.0E-25
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 101 293 1.0E-24
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 82 288 2.0E-18
sp|Q8VE97|SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus GN=Srsf4 PE=2 SV=1 100 292 1.0E-17
sp|Q08170|SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens GN=SRSF4 PE=1 SV=2 100 292 1.0E-17
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 90 288 2.0E-16
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 97 288 2.0E-13
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 97 288 2.0E-13
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 80 278 8.0E-13
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 214 294 1.0E-11
sp|Q9D0E1|HNRPM_MOUSE Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus GN=Hnrnpm PE=1 SV=3 214 294 1.0E-11
sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 214 294 1.0E-11
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 80 278 3.0E-11
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 212 294 9.0E-11
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 101 284 1.0E-10
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 100 177 2.0E-10
sp|Q9D0E1|HNRPM_MOUSE Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus GN=Hnrnpm PE=1 SV=3 100 177 2.0E-10
sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 100 177 2.0E-10
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 212 294 2.0E-10
sp|P78814|SRP2_SCHPO Pre-mRNA-splicing factor srp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp2 PE=1 SV=2 100 177 2.0E-10
sp|G3V6S8|SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus GN=Srsf6 PE=1 SV=1 100 292 3.0E-10
sp|Q3TWW8|SRSF6_MOUSE Serine/arginine-rich splicing factor 6 OS=Mus musculus GN=Srsf6 PE=1 SV=1 100 292 3.0E-10
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 24 288 4.0E-10
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 71 290 4.0E-10
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 100 177 5.0E-10
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 91 304 5.0E-10
sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 100 292 9.0E-10
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 100 177 1.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 97 289 1.0E-09
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 101 286 2.0E-09
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 101 288 2.0E-09
sp|Q3B7L6|SRSF6_BOVIN Serine/arginine-rich splicing factor 6 OS=Bos taurus GN=SRSF6 PE=2 SV=1 100 292 3.0E-09
sp|P26686|SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster GN=B52 PE=1 SV=4 100 174 3.0E-09
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 101 288 4.0E-09
sp|P26686|SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster GN=B52 PE=1 SV=4 100 291 4.0E-09
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 97 289 5.0E-09
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 101 288 6.0E-09
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 84 288 8.0E-09
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 61 278 8.0E-09
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 94 288 1.0E-08
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 78 278 2.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 78 278 2.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 78 278 2.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 78 278 2.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 78 278 2.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 78 278 2.0E-08
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 84 288 2.0E-08
sp|Q09167|SRSF5_RAT Serine/arginine-rich splicing factor 5 OS=Rattus norvegicus GN=Srsf5 PE=1 SV=1 77 173 3.0E-08
sp|O35326|SRSF5_MOUSE Serine/arginine-rich splicing factor 5 OS=Mus musculus GN=Srsf5 PE=1 SV=2 77 173 3.0E-08
sp|Q13243|SRSF5_HUMAN Serine/arginine-rich splicing factor 5 OS=Homo sapiens GN=SRSF5 PE=1 SV=1 77 173 3.0E-08
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 86 288 3.0E-08
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 101 288 3.0E-08
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 101 288 3.0E-08
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 101 288 3.0E-08
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 84 278 3.0E-08
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 84 278 3.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 100 286 4.0E-08
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 84 288 4.0E-08
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 84 288 5.0E-08
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 94 288 6.0E-08
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 99 286 6.0E-08
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 99 286 6.0E-08
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 80 278 7.0E-08
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 80 278 7.0E-08
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 80 278 7.0E-08
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 99 286 7.0E-08
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 79 315 8.0E-08
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 101 288 9.0E-08
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 101 288 1.0E-07
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 100 292 1.0E-07
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 101 288 2.0E-07
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 80 278 2.0E-07
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 80 278 2.0E-07
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 101 288 2.0E-07
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 83 288 2.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 94 292 3.0E-07
sp|P78814|SRP2_SCHPO Pre-mRNA-splicing factor srp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp2 PE=1 SV=2 100 291 3.0E-07
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 80 278 3.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 77 175 4.0E-07
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 83 278 4.0E-07
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 83 288 4.0E-07
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 99 286 5.0E-07
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 99 176 7.0E-07
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 83 288 7.0E-07
sp|Q09167|SRSF5_RAT Serine/arginine-rich splicing factor 5 OS=Rattus norvegicus GN=Srsf5 PE=1 SV=1 100 290 8.0E-07
sp|O35326|SRSF5_MOUSE Serine/arginine-rich splicing factor 5 OS=Mus musculus GN=Srsf5 PE=1 SV=2 100 290 8.0E-07
sp|Q13243|SRSF5_HUMAN Serine/arginine-rich splicing factor 5 OS=Homo sapiens GN=SRSF5 PE=1 SV=1 100 290 8.0E-07
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 83 233 8.0E-07
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 99 286 8.0E-07
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 101 278 1.0E-06
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 80 278 1.0E-06
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 101 324 1.0E-06
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 101 284 1.0E-06
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 101 288 2.0E-06
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 86 288 2.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 101 278 2.0E-06
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 215 307 2.0E-06
sp|Q8L719|THO4B_ARATH THO complex subunit 4B OS=Arabidopsis thaliana GN=ALY2 PE=1 SV=1 212 289 2.0E-06
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 101 288 3.0E-06
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 101 278 3.0E-06
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 101 179 5.0E-06
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 84 288 5.0E-06
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 86 288 5.0E-06
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 101 278 5.0E-06
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 101 278 5.0E-06
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 77 201 5.0E-06
sp|Q61545|EWS_MOUSE RNA-binding protein EWS OS=Mus musculus GN=Ewsr1 PE=1 SV=2 215 288 5.0E-06
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 101 278 6.0E-06
sp|Q23120|RSP2_CAEEL Probable splicing factor, arginine/serine-rich 2 OS=Caenorhabditis elegans GN=rsp-2 PE=3 SV=1 100 291 6.0E-06
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 101 288 7.0E-06
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 212 289 8.0E-06
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 101 278 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3195
MADPGDTYRPRERSRSPRRRSRSPGRQSRRRSYSPRSRSNSRDDQRRGRDRTPMTAAGTPGGGSVAGFGGQVSNR
SYEDRAATREQRMNSLRENSQQDRRVYVGNLSYDVKWHHLKDFMRQAGEVIFADVLLLPNGMSKGCGIVEYATRD
QAQQAVTQLSNQNLMGRLVYVREDREAEPRFIGSSGGNRGGFGNSMTGFNHAYSGTATSAGGRQVYVANLPYNVG
WQDLKDLFRQATRMGNVFRADVHVGHDGRPKGSGVVVFESPDDARNAIQQFNGYDWQGRLLDVHEDRFASTGGTS
FSGRGGYGGGMRGGFGNNFGRGGFGGGHAGFGFGARGGFSGGGSGSGSGSGNGNGGSKGRRY*
Coding >OphauG2|3195
ATGGCCGACCCTGGCGACACTTACCGACCCCGCGAGAGGTCTCGATCGCCTCGTCGACGCTCTAGAAGTCCTGGC
AGACAGTCTCGCCGCCGTTCTTATTCTCCACGCAGCAGATCAAACAGCCGAGACGACCAGCGACGTGGCCGTGAT
CGTACACCCATGACGGCAGCAGGCACACCAGGTGGTGGATCTGTCGCTGGCTTTGGCGGCCAAGTCAGCAATCGG
TCGTACGAGGATCGCGCCGCCACACGCGAGCAAAGAATGAACAGTCTTCGCGAGAATTCGCAACAGGATCGCCGC
GTCTATGTCGGTAATCTTTCTTACGACGTAAAATGGCACCACCTTAAAGACTTTATGAGACAAGCTGGAGAAGTC
ATATTTGCCGATGTATTGCTTCTACCCAATGGCATGTCCAAGGGATGCGGCATCGTCGAATACGCCACAAGAGAT
CAGGCTCAACAAGCTGTAACTCAACTCAGCAACCAAAATCTCATGGGCCGACTGGTATACGTTCGAGAAGATCGC
GAAGCAGAGCCTCGCTTTATTGGCTCCAGCGGCGGTAATAGAGGTGGCTTCGGTAATAGCATGACGGGTTTCAAC
CATGCTTATAGCGGTACAGCAACAAGCGCTGGAGGACGCCAGGTTTATGTTGCCAATTTGCCATATAACGTTGGA
TGGCAAGATTTGAAAGATCTTTTTCGGCAAGCCACTCGGATGGGTAACGTTTTTCGCGCCGATGTGCACGTTGGA
CACGACGGCCGACCTAAGGGTTCTGGTGTCGTCGTTTTTGAAAGCCCCGACGATGCTCGCAATGCTATTCAACAA
TTCAATGGCTATGACTGGCAAGGCCGACTGCTTGACGTTCATGAAGATCGCTTTGCCTCTACTGGAGGTACAAGT
TTCTCCGGTCGTGGTGGCTACGGCGGAGGAATGCGCGGTGGCTTCGGCAATAACTTCGGCCGTGGCGGCTTTGGT
GGTGGCCACGCTGGATTTGGCTTTGGTGCACGTGGGGGCTTCAGTGGCGGCGGCAGCGGCAGCGGCAGCGGCAGT
GGCAATGGCAACGGTGGCTCCAAGGGCCGCCGCTACTAG
Transcript >OphauG2|3195
ATGGCCGACCCTGGCGACACTTACCGACCCCGCGAGAGGTCTCGATCGCCTCGTCGACGCTCTAGAAGTCCTGGC
AGACAGTCTCGCCGCCGTTCTTATTCTCCACGCAGCAGATCAAACAGCCGAGACGACCAGCGACGTGGCCGTGAT
CGTACACCCATGACGGCAGCAGGCACACCAGGTGGTGGATCTGTCGCTGGCTTTGGCGGCCAAGTCAGCAATCGG
TCGTACGAGGATCGCGCCGCCACACGCGAGCAAAGAATGAACAGTCTTCGCGAGAATTCGCAACAGGATCGCCGC
GTCTATGTCGGTAATCTTTCTTACGACGTAAAATGGCACCACCTTAAAGACTTTATGAGACAAGCTGGAGAAGTC
ATATTTGCCGATGTATTGCTTCTACCCAATGGCATGTCCAAGGGATGCGGCATCGTCGAATACGCCACAAGAGAT
CAGGCTCAACAAGCTGTAACTCAACTCAGCAACCAAAATCTCATGGGCCGACTGGTATACGTTCGAGAAGATCGC
GAAGCAGAGCCTCGCTTTATTGGCTCCAGCGGCGGTAATAGAGGTGGCTTCGGTAATAGCATGACGGGTTTCAAC
CATGCTTATAGCGGTACAGCAACAAGCGCTGGAGGACGCCAGGTTTATGTTGCCAATTTGCCATATAACGTTGGA
TGGCAAGATTTGAAAGATCTTTTTCGGCAAGCCACTCGGATGGGTAACGTTTTTCGCGCCGATGTGCACGTTGGA
CACGACGGCCGACCTAAGGGTTCTGGTGTCGTCGTTTTTGAAAGCCCCGACGATGCTCGCAATGCTATTCAACAA
TTCAATGGCTATGACTGGCAAGGCCGACTGCTTGACGTTCATGAAGATCGCTTTGCCTCTACTGGAGGTACAAGT
TTCTCCGGTCGTGGTGGCTACGGCGGAGGAATGCGCGGTGGCTTCGGCAATAACTTCGGCCGTGGCGGCTTTGGT
GGTGGCCACGCTGGATTTGGCTTTGGTGCACGTGGGGGCTTCAGTGGCGGCGGCAGCGGCAGCGGCAGCGGCAGT
GGCAATGGCAACGGTGGCTCCAAGGGCCGCCGCTACTAG
Gene >OphauG2|3195
ATGGGTACGTTGGACCTGTCTCGTCGCATCTTGATGAATATGATATCAGCTGGTTACTGCAAGCCCCTCCATCGT
CGACCAATGTTGGACAGGTTCAAGAGGCTTCATGTATCACGGCCGCCTCCAGCACAAGAATGTAACCCGTCACTG
TCAGTCCTTGACCTGCATGTCTCCCACCCACATGTCCATCTCGGTGGCCCAGAGCCGTCCGGCTTTGCTGCCACC
CCACCACCACCTCTGCCAGGACACGTCGACTCGACTTCTTTCTACCCGACCTGCGTCTGCCATGACTGTTGTCCT
TATTACAAGCAGCTTTCCACTCCCCGCTCTCCCCCCCCTTTTTCTCTCGATCTGATCTTCTCTTCATACTTTCTT
TTGGCTTGTTGCTTCTTCGCCAAGGTCAAAACTGACAGTTGCTCAATTTGTTTACAGCCGACCCTGGCGACACTT
ACCGACCCGTGAGTCCCGTTTCCATATTTTCTTTTGTGCTGATATTGCTGGCGTGGATGGGCAGCTTTGCCAAGT
TGATACTCAACGAAGCGCCGCTGCCCTCTAGCATTATGTTGCTGTCTCCACATCTCTCCACCTCGATTACATTCT
CCTCTGCTTCGTCTCGCGCGCCCTCCTGAGTCTCTTGAGCCCCTTTTTCTTTTTATACCTGTCCTTTGCAGATTA
CATTTCCTGCCTTGATTCAATACCATGTGCTGCGCTGCGCATCTTGCCAGCAAGGCTACTACTTCGGCTTGCTGC
CGCGCTGCGCACAGTGGGGAAATCAAATTGAATAGTTTCTCCGCAACTTGGCTCCTGCGCGCCGCCCGCTCTTTT
CATCCACCATTTGCCATCGACAAGTTTTCTCGTTTTGGCCATTGGCGCCCGATGCACCCCATCCTCGCGCCCTAG
ATTTTACTTGCTGCCCTCGTTAACACGATATCCCGACTTCGCTGGCCCAGCTTGCAGCTAATATGTCTCAGCGCG
AGAGGTCTCGATCGCCTCGTCGACGCTCTAGAAGTCCTGGCAGACAGTCTCGCCGCCGTTCTTATTCTCCACGCA
GCAGATCAAACAGCCGAGACGACCAGCGACGTGGCCGTGATCGTACACCCATGACGGCAGCAGGCACACCAGGTG
GTGGATCTGTCGCTGGCTTTGGCGGCCAAGTCAGCAATCGGTCGTACGAGGATCGCGCCGCCACACGCGAGCAAA
GAATGAACAGTCTTCGCGAGAATTCGCAACAGGATCGCCGCGTCTATGTCGGTAATCTTTCTTACGACGTAAAAT
GGCACCACCTTAAAGACTTTATGAGACAAGGTTGGCCTCCAAGTCAACTCCCTACCGTTGACGTCTCAATTACTT
ACTTGGCTCCATCTGCTAGCTGGAGAAGTCATATTTGCCGATGTATTGCTTCTACCCAATGGCATGTCCAAGGTA
CGCTTTACCATCACCTCTGTCCATTAATCCGTATCCTCTCCCTCGACAACTAACCTAGCTCTTTTGTCTGCATGT
AGGGATGCGGGTAAGTCTCGTTATGGTTGATGCAACTCCACTTCGTTGACCAATTGCCCATGTGTTTATATCAGC
ATCGTCGAATACGCCACAAGAGATCAGGCTCAACAAGCTGTAACTCAACTCAGCAACCAAAATCTCATGGGCCGA
CTGGTATACGTTCGAGAAGTGTGTGGCCGCTTTTTTCTTTCCCCTCCAATTCATGCATCCAGCTGACTCTCAATT
ACACCAGGATCGCGAAGCAGAGCCTCGCTTTATTGGCTCCAGCGGCGGTAATAGAGGTGGCTTCGGTAATAGCAT
GACGGGTTTCAACCATGCTTATAGCGGTACAGCAACAAGCGCTGGAGGACGCCAGGTTTATGTTGCCAATGTAGG
TGTACTCTCAGACTTATCGCCTTTTATTTTTTGGGGTGTAAGGGGTGTGGGGGGCATCTGACGCCGCTAATCTAT
GTCTCTATTCAGTTGCCATATAACGTTGGATGGCAAGATTTGAAAGATCTTTTTCGGCAAGCCAGTATGTGACGC
GCATTCCTTATAACTACGAAATTCATACTTACCATTAACAGCTCGGATGGGTAACGTTTTTCGCGCCGATGTGCA
CGTTGGACACGACGGCCGACCTAAGGGTTCTGGTGTCGTCGTTTTTGAAAGCCCCGACGATGCTCGCAATGCTAT
TCAACAATTCAATGGCTATGACTGGCAAGGCCGACTGCTTGACGTTCATGAAGATCGCTTTGCCTCTACTGGAGG
TACAAGTTTCTCCGGTCGTGGTGGCTACGGCGGAGGAATGCGCGGTGGCTTCGGCAATAACTTCGGCCGTGGCGG
CTTTGGTGGTGGCCACGCTGGATTTGGCTTTGGTGCACGTGGGGGCTTCAGTGGCGGCGGCAGCGGCAGCGGCAG
CGGCAGTGGCAATGGCAACGGTGGCTCCAAGGGCCGCCGCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail