Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3194
Gene name
LocationContig_236:17324..19205
Strand+
Gene length (bp)1881
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10396 TrmE_N GTP-binding protein TrmE N-terminus 2.8E-36 70 195
PF12631 MnmE_helical MnmE helical domain 4.5E-33 198 570
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-17 297 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q969Y2|GTPB3_HUMAN tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens GN=GTPBP3 PE=1 SV=2 54 573 8.0E-85
sp|B0CJG2|MNME_BRUSI tRNA modification GTPase MnmE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mnmE PE=3 SV=1 69 573 6.0E-81
sp|A9M9E5|MNME_BRUC2 tRNA modification GTPase MnmE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mnmE PE=3 SV=1 69 573 6.0E-81
sp|P32559|MSS1_YEAST tRNA modification GTPase MSS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS1 PE=1 SV=2 70 573 8.0E-81
sp|Q8CY34|MNME_BRUSU tRNA modification GTPase MnmE OS=Brucella suis biovar 1 (strain 1330) GN=mnmE PE=3 SV=1 69 573 2.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q969Y2|GTPB3_HUMAN tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens GN=GTPBP3 PE=1 SV=2 54 573 8.0E-85
sp|B0CJG2|MNME_BRUSI tRNA modification GTPase MnmE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mnmE PE=3 SV=1 69 573 6.0E-81
sp|A9M9E5|MNME_BRUC2 tRNA modification GTPase MnmE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mnmE PE=3 SV=1 69 573 6.0E-81
sp|P32559|MSS1_YEAST tRNA modification GTPase MSS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS1 PE=1 SV=2 70 573 8.0E-81
sp|Q8CY34|MNME_BRUSU tRNA modification GTPase MnmE OS=Brucella suis biovar 1 (strain 1330) GN=mnmE PE=3 SV=1 69 573 2.0E-80
sp|Q8YJS6|MNME_BRUME tRNA modification GTPase MnmE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mnmE PE=3 SV=1 69 573 2.0E-80
sp|Q57AJ6|MNME_BRUAB tRNA modification GTPase MnmE OS=Brucella abortus biovar 1 (strain 9-941) GN=mnmE PE=3 SV=1 69 573 4.0E-80
sp|Q2YR11|MNME_BRUA2 tRNA modification GTPase MnmE OS=Brucella abortus (strain 2308) GN=mnmE PE=3 SV=1 69 573 4.0E-80
sp|Q9UTE7|MSS1_SCHPO tRNA modification GTPase mss1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mss1 PE=3 SV=1 70 573 8.0E-80
sp|A5VT20|MNME_BRUO2 tRNA modification GTPase MnmE OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mnmE PE=3 SV=1 69 573 2.0E-78
sp|Q501Z5|GTPB3_DANRE tRNA modification GTPase GTPBP3, mitochondrial OS=Danio rerio GN=gtpbp3 PE=2 SV=1 68 573 2.0E-78
sp|Q16CZ5|MNME_ROSDO tRNA modification GTPase MnmE OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mnmE PE=3 SV=1 69 573 7.0E-78
sp|Q5PQQ1|GTPB3_RAT tRNA modification GTPase GTPBP3, mitochondrial OS=Rattus norvegicus GN=Gtpbp3 PE=2 SV=1 70 573 1.0E-77
sp|Q55C52|GTPB3_DICDI tRNA modification GTPase gtpbp3, mitochondrial OS=Dictyostelium discoideum GN=gtpbp3 PE=3 SV=1 69 573 2.0E-77
sp|Q98DZ0|MNME_RHILO tRNA modification GTPase MnmE OS=Rhizobium loti (strain MAFF303099) GN=mnmE PE=3 SV=1 67 573 1.0E-76
sp|Q923K4|GTPB3_MOUSE tRNA modification GTPase GTPBP3, mitochondrial OS=Mus musculus GN=Gtpbp3 PE=2 SV=1 59 573 2.0E-76
sp|P0CAX2|MNME_CAUCR tRNA modification GTPase MnmE OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mnmE PE=3 SV=1 69 573 1.0E-75
sp|B8GW34|MNME_CAUCN tRNA modification GTPase MnmE OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mnmE PE=3 SV=2 69 573 1.0E-75
sp|A8GUF3|MNME_RICB8 tRNA modification GTPase MnmE OS=Rickettsia bellii (strain OSU 85-389) GN=mnmE PE=3 SV=1 69 573 2.0E-75
sp|Q1RKJ6|MNME_RICBR tRNA modification GTPase MnmE OS=Rickettsia bellii (strain RML369-C) GN=mnmE PE=3 SV=1 69 573 3.0E-75
sp|A8GPN6|MNME_RICAH tRNA modification GTPase MnmE OS=Rickettsia akari (strain Hartford) GN=mnmE PE=3 SV=1 69 573 1.0E-74
sp|B4RD04|MNME_PHEZH tRNA modification GTPase MnmE OS=Phenylobacterium zucineum (strain HLK1) GN=mnmE PE=3 SV=1 69 573 2.0E-74
sp|Q9ZCI1|MNME_RICPR tRNA modification GTPase MnmE OS=Rickettsia prowazekii (strain Madrid E) GN=mnmE PE=3 SV=1 69 573 2.0E-74
sp|A7HSK9|MNME_PARL1 tRNA modification GTPase MnmE OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mnmE PE=3 SV=1 69 388 1.0E-73
sp|A8GTM1|MNME_RICRS tRNA modification GTPase MnmE OS=Rickettsia rickettsii (strain Sheila Smith) GN=mnmE PE=3 SV=1 69 573 2.0E-73
sp|B0BV57|MNME_RICRO tRNA modification GTPase MnmE OS=Rickettsia rickettsii (strain Iowa) GN=mnmE PE=3 SV=1 69 573 2.0E-73
sp|Q6G1K8|MNME_BARHE tRNA modification GTPase MnmE OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mnmE PE=3 SV=1 69 573 2.0E-73
sp|A9IZY1|MNME_BART1 tRNA modification GTPase MnmE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mnmE PE=3 SV=1 69 573 3.0E-73
sp|Q92GE8|MNME_RICCN tRNA modification GTPase MnmE OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mnmE PE=3 SV=1 69 573 8.0E-73
sp|B2IJQ3|MNME_BEII9 tRNA modification GTPase MnmE OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=mnmE PE=3 SV=1 60 573 3.0E-72
sp|Q2WBH0|MNME_MAGSA tRNA modification GTPase MnmE OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mnmE PE=3 SV=2 69 573 4.0E-72
sp|Q68VZ0|MNME_RICTY tRNA modification GTPase MnmE OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mnmE PE=3 SV=1 69 573 7.0E-72
sp|Q4UK70|MNME_RICFE tRNA modification GTPase MnmE OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mnmE PE=3 SV=1 69 573 2.0E-71
sp|A6WX76|MNME_OCHA4 tRNA modification GTPase MnmE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mnmE PE=3 SV=1 69 573 3.0E-71
sp|Q2GIJ8|MNME_ANAPZ tRNA modification GTPase MnmE OS=Anaplasma phagocytophilum (strain HZ) GN=mnmE PE=3 SV=1 69 573 9.0E-71
sp|A8F2P7|MNME_RICM5 tRNA modification GTPase MnmE OS=Rickettsia massiliae (strain Mtu5) GN=mnmE PE=3 SV=1 69 573 2.0E-70
sp|A8I264|MNME_AZOC5 tRNA modification GTPase MnmE OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mnmE PE=3 SV=1 67 387 5.0E-70
sp|B0T6E0|MNME_CAUSK tRNA modification GTPase MnmE OS=Caulobacter sp. (strain K31) GN=mnmE PE=3 SV=1 68 573 8.0E-70
sp|Q5GTQ0|MNME_WOLTR tRNA modification GTPase MnmE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mnmE PE=3 SV=1 67 573 1.0E-69
sp|Q5NKZ8|MNME_ZYMMO tRNA modification GTPase MnmE OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=mnmE PE=3 SV=1 70 573 1.0E-69
sp|Q07UP2|MNME_RHOP5 tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain BisA53) GN=mnmE PE=3 SV=2 66 573 4.0E-69
sp|Q21CM0|MNME_RHOPB tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain BisB18) GN=mnmE PE=3 SV=1 70 573 4.0E-69
sp|Q11CN2|MNME_CHESB tRNA modification GTPase MnmE OS=Chelativorans sp. (strain BNC1) GN=mnmE PE=3 SV=1 69 573 6.0E-69
sp|B3CMJ7|MNME_WOLPP tRNA modification GTPase MnmE OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=mnmE PE=3 SV=1 67 573 6.0E-69
sp|Q0AKE8|MNME_MARMM tRNA modification GTPase MnmE OS=Maricaulis maris (strain MCS10) GN=mnmE PE=3 SV=1 70 573 9.0E-69
sp|B3PS53|MNME_RHIE6 tRNA modification GTPase MnmE OS=Rhizobium etli (strain CIAT 652) GN=mnmE PE=3 SV=1 68 573 2.0E-68
sp|C0R405|MNME_WOLWR tRNA modification GTPase MnmE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mnmE PE=3 SV=1 67 573 3.0E-68
sp|A8EZV9|MNME_RICCK tRNA modification GTPase MnmE OS=Rickettsia canadensis (strain McKiel) GN=mnmE PE=3 SV=1 69 573 3.0E-68
sp|A3PNS7|MNME_RHOS1 tRNA modification GTPase MnmE OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mnmE PE=3 SV=1 69 573 1.0E-67
sp|Q1MA18|MNME_RHIL3 tRNA modification GTPase MnmE OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mnmE PE=3 SV=1 69 573 2.0E-67
sp|B0UJI9|MNME_METS4 tRNA modification GTPase MnmE OS=Methylobacterium sp. (strain 4-46) GN=mnmE PE=3 SV=1 69 573 2.0E-67
sp|A9CHB2|MNME_AGRFC tRNA modification GTPase MnmE OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mnmE PE=3 SV=1 65 386 2.0E-67
sp|Q73GH3|MNME_WOLPM tRNA modification GTPase MnmE OS=Wolbachia pipientis wMel GN=mnmE PE=3 SV=1 67 573 3.0E-67
sp|Q6FYB8|MNME_BARQU tRNA modification GTPase MnmE OS=Bartonella quintana (strain Toulouse) GN=mnmE PE=3 SV=1 69 573 8.0E-67
sp|A6UEE9|MNME_SINMW tRNA modification GTPase MnmE OS=Sinorhizobium medicae (strain WSM419) GN=mnmE PE=3 SV=1 69 387 1.0E-66
sp|A5E8G7|MNME_BRASB tRNA modification GTPase MnmE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mnmE PE=3 SV=1 68 573 1.0E-66
sp|A4YJT5|MNME_BRASO tRNA modification GTPase MnmE OS=Bradyrhizobium sp. (strain ORS278) GN=mnmE PE=3 SV=1 68 573 6.0E-66
sp|Q4FNR7|MNME_PELUB tRNA modification GTPase MnmE OS=Pelagibacter ubique (strain HTCC1062) GN=mnmE PE=3 SV=1 70 573 6.0E-66
sp|A8LPC2|MNME_DINSH tRNA modification GTPase MnmE OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mnmE PE=3 SV=1 69 406 8.0E-66
sp|Q5P9B1|MNME_ANAMM tRNA modification GTPase MnmE OS=Anaplasma marginale (strain St. Maries) GN=mnmE PE=3 SV=1 69 573 1.0E-65
sp|Q13E22|MNME_RHOPS tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain BisB5) GN=mnmE PE=3 SV=2 67 573 4.0E-65
sp|A9HE16|MNME_GLUDA tRNA modification GTPase MnmE OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=mnmE PE=3 SV=1 65 573 7.0E-65
sp|Q2J357|MNME_RHOP2 tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain HaA2) GN=mnmE PE=3 SV=1 67 573 8.0E-65
sp|Q92KW1|MNME_RHIME tRNA modification GTPase MnmE OS=Rhizobium meliloti (strain 1021) GN=mnmE PE=3 SV=2 67 387 9.0E-65
sp|Q3YT72|MNME_EHRCJ tRNA modification GTPase MnmE OS=Ehrlichia canis (strain Jake) GN=mnmE PE=3 SV=1 70 573 1.0E-64
sp|Q2GI42|MNME_EHRCR tRNA modification GTPase MnmE OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mnmE PE=3 SV=1 70 573 3.0E-64
sp|Q3IYH3|MNME_RHOS4 tRNA modification GTPase MnmE OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mnmE PE=3 SV=1 69 406 4.0E-64
sp|Q5FF19|MNME_EHRRG tRNA modification GTPase MnmE OS=Ehrlichia ruminantium (strain Gardel) GN=mnmE PE=3 SV=1 70 573 2.0E-63
sp|Q3SWH5|MNME_NITWN tRNA modification GTPase MnmE OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mnmE PE=3 SV=1 70 573 5.0E-63
sp|A4WVZ0|MNME_RHOS5 tRNA modification GTPase MnmE OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mnmE PE=3 SV=1 69 404 3.0E-62
sp|Q5HCD7|MNME_EHRRW tRNA modification GTPase MnmE OS=Ehrlichia ruminantium (strain Welgevonden) GN=mnmE PE=3 SV=1 70 573 5.0E-62
sp|A1UQU6|MNME_BARBK tRNA modification GTPase MnmE OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mnmE PE=3 SV=1 69 393 1.0E-61
sp|Q0BW92|MNME_GRABC tRNA modification GTPase MnmE OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mnmE PE=3 SV=1 67 573 2.0E-61
sp|Q1GCM0|MNME_RUEST tRNA modification GTPase MnmE OS=Ruegeria sp. (strain TM1040) GN=mnmE PE=3 SV=1 69 387 3.0E-61
sp|A5CFM7|MNME_ORITB tRNA modification GTPase MnmE OS=Orientia tsutsugamushi (strain Boryong) GN=mnmE PE=3 SV=1 70 573 1.0E-60
sp|B1M0E0|MNME_METRJ tRNA modification GTPase MnmE OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=mnmE PE=3 SV=1 69 573 4.0E-60
sp|Q2N6I9|MNME_ERYLH tRNA modification GTPase MnmE OS=Erythrobacter litoralis (strain HTCC2594) GN=mnmE PE=3 SV=1 69 573 7.0E-60
sp|Q2K2S0|MNME_RHIEC tRNA modification GTPase MnmE OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mnmE PE=3 SV=2 69 374 8.0E-60
sp|Q5LLM7|MNME_RUEPO tRNA modification GTPase MnmE OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mnmE PE=3 SV=1 69 386 1.0E-59
sp|Q2GC37|MNME_NOVAD tRNA modification GTPase MnmE OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=mnmE PE=3 SV=1 69 399 2.0E-59
sp|Q5FS11|MNME_GLUOX tRNA modification GTPase MnmE OS=Gluconobacter oxydans (strain 621H) GN=mnmE PE=3 SV=1 66 386 2.0E-59
sp|Q89WP4|MNME_BRADU tRNA modification GTPase MnmE OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mnmE PE=3 SV=1 68 573 5.0E-59
sp|O67030|MNME_AQUAE tRNA modification GTPase MnmE OS=Aquifex aeolicus (strain VF5) GN=mnmE PE=3 SV=1 71 573 6.0E-59
sp|Q2RN77|MNME_RHORT tRNA modification GTPase MnmE OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mnmE PE=3 SV=1 69 433 6.0E-59
sp|Q2GD53|MNME_NEOSM tRNA modification GTPase MnmE OS=Neorickettsia sennetsu (strain Miyayama) GN=mnmE PE=3 SV=1 70 389 1.0E-58
sp|A1WWE4|MNME_HALHL tRNA modification GTPase MnmE OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mnmE PE=3 SV=1 69 573 1.0E-58
sp|Q31DJ0|MNME_THICR tRNA modification GTPase MnmE OS=Thiomicrospira crunogena (strain XCL-2) GN=mnmE PE=3 SV=2 66 573 8.0E-58
sp|A3M8Y8|MNME_ACIBT tRNA modification GTPase MnmE OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=mnmE PE=3 SV=2 67 573 2.0E-57
sp|Q82XA1|MNME_NITEU tRNA modification GTPase MnmE OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mnmE PE=3 SV=1 67 573 2.0E-57
sp|A0LE48|MNME_MAGMM tRNA modification GTPase MnmE OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mnmE PE=3 SV=1 69 573 3.0E-57
sp|B1ZGG9|MNME_METPB tRNA modification GTPase MnmE OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=mnmE PE=3 SV=1 65 573 3.0E-57
sp|B0V5S5|MNME_ACIBY tRNA modification GTPase MnmE OS=Acinetobacter baumannii (strain AYE) GN=mnmE PE=3 SV=1 67 573 5.0E-57
sp|A4WGH1|MNME_ENT38 tRNA modification GTPase MnmE OS=Enterobacter sp. (strain 638) GN=mnmE PE=3 SV=1 68 573 7.0E-57
sp|P94612|MNME_COXBU tRNA modification GTPase MnmE OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mnmE PE=3 SV=1 69 573 7.0E-57
sp|A9NBA7|MNME_COXBR tRNA modification GTPase MnmE OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mnmE PE=3 SV=1 69 573 7.0E-57
sp|A9KBS9|MNME_COXBN tRNA modification GTPase MnmE OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mnmE PE=3 SV=1 69 573 7.0E-57
sp|Q1QRZ0|MNME_NITHX tRNA modification GTPase MnmE OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mnmE PE=3 SV=1 70 573 8.0E-57
sp|Q3J6L9|MNME_NITOC tRNA modification GTPase MnmE OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mnmE PE=3 SV=1 58 573 8.0E-57
sp|A2BUG6|MNME_PROM5 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9515) GN=mnmE PE=3 SV=1 67 573 9.0E-57
sp|B5BIL9|MNME_SALPK tRNA modification GTPase MnmE OS=Salmonella paratyphi A (strain AKU_12601) GN=mnmE PE=3 SV=1 68 573 1.0E-56
sp|A4VS81|MNME_PSEU5 tRNA modification GTPase MnmE OS=Pseudomonas stutzeri (strain A1501) GN=mnmE PE=3 SV=1 69 573 2.0E-56
sp|Q7MAX1|MNME_PHOLL tRNA modification GTPase MnmE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mnmE PE=3 SV=1 67 573 2.0E-56
sp|B4TN11|MNME_SALSV tRNA modification GTPase MnmE OS=Salmonella schwarzengrund (strain CVM19633) GN=mnmE PE=3 SV=1 68 573 4.0E-56
sp|A9MX84|MNME_SALPB tRNA modification GTPase MnmE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mnmE PE=3 SV=2 68 573 4.0E-56
sp|B4SYB2|MNME_SALNS tRNA modification GTPase MnmE OS=Salmonella newport (strain SL254) GN=mnmE PE=3 SV=1 68 573 4.0E-56
sp|B5QUQ5|MNME_SALEP tRNA modification GTPase MnmE OS=Salmonella enteritidis PT4 (strain P125109) GN=mnmE PE=3 SV=1 68 573 4.0E-56
sp|Q57HZ6|MNME_SALCH tRNA modification GTPase MnmE OS=Salmonella choleraesuis (strain SC-B67) GN=mnmE PE=3 SV=1 68 573 4.0E-56
sp|B7UMH3|MNME_ECO27 tRNA modification GTPase MnmE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mnmE PE=3 SV=1 66 573 5.0E-56
sp|A1JT87|MNME_YERE8 tRNA modification GTPase MnmE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mnmE PE=3 SV=1 66 573 5.0E-56
sp|Q8ZKY3|MNME_SALTY tRNA modification GTPase MnmE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mnmE PE=3 SV=1 68 573 6.0E-56
sp|Q8Z2N8|MNME_SALTI tRNA modification GTPase MnmE OS=Salmonella typhi GN=mnmE PE=3 SV=1 68 573 6.0E-56
sp|C0Q2L4|MNME_SALPC tRNA modification GTPase MnmE OS=Salmonella paratyphi C (strain RKS4594) GN=mnmE PE=3 SV=1 68 573 7.0E-56
sp|Q477Q5|MNME_DECAR tRNA modification GTPase MnmE OS=Dechloromonas aromatica (strain RCB) GN=mnmE PE=3 SV=1 69 573 8.0E-56
sp|Q1R4M8|MNME_ECOUT tRNA modification GTPase MnmE OS=Escherichia coli (strain UTI89 / UPEC) GN=mnmE PE=3 SV=1 66 573 8.0E-56
sp|Q8FBV3|MNME_ECOL6 tRNA modification GTPase MnmE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mnmE PE=3 SV=1 66 573 8.0E-56
sp|Q0TB01|MNME_ECOL5 tRNA modification GTPase MnmE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mnmE PE=3 SV=1 66 573 8.0E-56
sp|A1AHP0|MNME_ECOK1 tRNA modification GTPase MnmE OS=Escherichia coli O1:K1 / APEC GN=mnmE PE=3 SV=1 66 573 8.0E-56
sp|B7MGC8|MNME_ECO45 tRNA modification GTPase MnmE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mnmE PE=3 SV=1 66 573 8.0E-56
sp|B7NR09|MNME_ECO7I tRNA modification GTPase MnmE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mnmE PE=3 SV=1 66 573 8.0E-56
sp|B7NF24|MNME_ECOLU tRNA modification GTPase MnmE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B3Q8A8|MNME_RHOPT tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain TIE-1) GN=mnmE PE=3 SV=1 67 408 1.0E-55
sp|Q31UW0|MNME_SHIBS tRNA modification GTPase MnmE OS=Shigella boydii serotype 4 (strain Sb227) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B2TUS2|MNME_SHIB3 tRNA modification GTPase MnmE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B6I3T9|MNME_ECOSE tRNA modification GTPase MnmE OS=Escherichia coli (strain SE11) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|P25522|MNME_ECOLI tRNA modification GTPase MnmE OS=Escherichia coli (strain K12) GN=mnmE PE=1 SV=3 66 573 1.0E-55
sp|B1IX32|MNME_ECOLC tRNA modification GTPase MnmE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B1X9T5|MNME_ECODH tRNA modification GTPase MnmE OS=Escherichia coli (strain K12 / DH10B) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|C4ZYY4|MNME_ECOBW tRNA modification GTPase MnmE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B7M559|MNME_ECO8A tRNA modification GTPase MnmE OS=Escherichia coli O8 (strain IAI1) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B7LK49|MNME_ESCF3 tRNA modification GTPase MnmE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B1LL33|MNME_ECOSM tRNA modification GTPase MnmE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|B7N211|MNME_ECO81 tRNA modification GTPase MnmE OS=Escherichia coli O81 (strain ED1a) GN=mnmE PE=3 SV=1 66 573 1.0E-55
sp|Q0BWA8|MNME_HYPNA tRNA modification GTPase MnmE OS=Hyphomonas neptunium (strain ATCC 15444) GN=mnmE PE=3 SV=1 66 382 1.0E-55
sp|A8A6G8|MNME_ECOHS tRNA modification GTPase MnmE OS=Escherichia coli O9:H4 (strain HS) GN=mnmE PE=3 SV=1 66 573 2.0E-55
sp|B7L851|MNME_ECO55 tRNA modification GTPase MnmE OS=Escherichia coli (strain 55989 / EAEC) GN=mnmE PE=3 SV=1 66 573 2.0E-55
sp|Q5PKU1|MNME_SALPA tRNA modification GTPase MnmE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mnmE PE=3 SV=1 68 573 2.0E-55
sp|C4K7P4|MNME_HAMD5 tRNA modification GTPase MnmE OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=mnmE PE=3 SV=1 69 573 2.0E-55
sp|Q3YWA7|MNME_SHISS tRNA modification GTPase MnmE OS=Shigella sonnei (strain Ss046) GN=mnmE PE=3 SV=1 66 573 2.0E-55
sp|Q7NPT9|MNME_CHRVO tRNA modification GTPase MnmE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mnmE PE=3 SV=1 70 573 2.0E-55
sp|Q83PL3|MNME_SHIFL tRNA modification GTPase MnmE OS=Shigella flexneri GN=mnmE PE=3 SV=1 66 573 2.0E-55
sp|Q0SYP6|MNME_SHIF8 tRNA modification GTPase MnmE OS=Shigella flexneri serotype 5b (strain 8401) GN=mnmE PE=3 SV=1 66 573 2.0E-55
sp|A9MJT6|MNME_SALAR tRNA modification GTPase MnmE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mnmE PE=3 SV=2 68 573 2.0E-55
sp|Q0AE55|MNME_NITEC tRNA modification GTPase MnmE OS=Nitrosomonas eutropha (strain C91) GN=mnmE PE=3 SV=2 67 573 3.0E-55
sp|B2UPK5|MNME_AKKM8 tRNA modification GTPase MnmE OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=mnmE PE=3 SV=1 83 573 3.0E-55
sp|Q329B1|MNME_SHIDS tRNA modification GTPase MnmE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mnmE PE=3 SV=1 66 573 3.0E-55
sp|B5RFY2|MNME_SALG2 tRNA modification GTPase MnmE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mnmE PE=3 SV=1 68 573 3.0E-55
sp|B5YXB0|MNME_ECO5E tRNA modification GTPase MnmE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mnmE PE=3 SV=1 66 573 4.0E-55
sp|Q8XB41|MNME_ECO57 tRNA modification GTPase MnmE OS=Escherichia coli O157:H7 GN=mnmE PE=3 SV=1 66 573 4.0E-55
sp|Q97CW2|MNME_CLOAB tRNA modification GTPase MnmE OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mnmE PE=3 SV=1 69 573 4.0E-55
sp|A1AXX6|MNME_PARDP tRNA modification GTPase MnmE OS=Paracoccus denitrificans (strain Pd 1222) GN=mnmE PE=3 SV=1 69 382 1.0E-54
sp|B4F0U0|MNME_PROMH tRNA modification GTPase MnmE OS=Proteus mirabilis (strain HI4320) GN=mnmE PE=3 SV=1 67 573 2.0E-54
sp|Q663S6|MNME_YERPS tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mnmE PE=3 SV=1 66 573 2.0E-54
sp|B2K868|MNME_YERPB tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mnmE PE=3 SV=1 66 573 2.0E-54
sp|Q6ND14|MNME_RHOPA tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mnmE PE=3 SV=1 67 408 2.0E-54
sp|A6M3M5|MNME_CLOB8 tRNA modification GTPase MnmE OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mnmE PE=3 SV=1 69 573 3.0E-54
sp|A4TSL0|MNME_YERPP tRNA modification GTPase MnmE OS=Yersinia pestis (strain Pestoides F) GN=mnmE PE=3 SV=1 66 573 3.0E-54
sp|Q1CCJ3|MNME_YERPN tRNA modification GTPase MnmE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mnmE PE=3 SV=1 66 573 3.0E-54
sp|A9R5S1|MNME_YERPG tRNA modification GTPase MnmE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mnmE PE=3 SV=1 66 573 3.0E-54
sp|Q1C0B3|MNME_YERPA tRNA modification GTPase MnmE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mnmE PE=3 SV=1 66 573 3.0E-54
sp|A8ACL8|MNME_CITK8 tRNA modification GTPase MnmE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mnmE PE=3 SV=2 68 573 3.0E-54
sp|A7ZTR2|MNME_ECO24 tRNA modification GTPase MnmE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mnmE PE=3 SV=1 66 573 3.0E-54
sp|Q4K396|MNME_PSEF5 tRNA modification GTPase MnmE OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mnmE PE=3 SV=1 69 573 3.0E-54
sp|A1TWI4|MNME_ACIAC tRNA modification GTPase MnmE OS=Acidovorax citrulli (strain AAC00-1) GN=mnmE PE=3 SV=1 65 573 4.0E-54
sp|A7FPC2|MNME_YERP3 tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mnmE PE=3 SV=1 66 573 5.0E-54
sp|Q8Z9U2|MNME_YERPE tRNA modification GTPase MnmE OS=Yersinia pestis GN=mnmE PE=3 SV=1 66 573 6.0E-54
sp|A4Y199|MNME_PSEMY tRNA modification GTPase MnmE OS=Pseudomonas mendocina (strain ymp) GN=mnmE PE=3 SV=1 69 573 6.0E-54
sp|B5XZP4|MNME_KLEP3 tRNA modification GTPase MnmE OS=Klebsiella pneumoniae (strain 342) GN=mnmE PE=3 SV=1 68 573 6.0E-54
sp|Q21DG1|MNME_SACD2 tRNA modification GTPase MnmE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mnmE PE=3 SV=1 67 573 8.0E-54
sp|B1JRQ1|MNME_YERPY tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mnmE PE=3 SV=1 66 573 1.0E-53
sp|A5IKF4|MNME_THEP1 tRNA modification GTPase MnmE OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mnmE PE=3 SV=1 69 573 1.0E-53
sp|B0S3V2|MNME_FINM2 tRNA modification GTPase MnmE OS=Finegoldia magna (strain ATCC 29328) GN=mnmE PE=3 SV=1 68 573 1.0E-53
sp|A4GAN2|MNME_HERAR tRNA modification GTPase MnmE OS=Herminiimonas arsenicoxydans GN=mnmE PE=3 SV=1 71 573 2.0E-53
sp|A4J9S1|MNME_DESRM tRNA modification GTPase MnmE OS=Desulfotomaculum reducens (strain MI-1) GN=mnmE PE=3 SV=1 68 573 2.0E-53
sp|A3PAQ7|MNME_PROM0 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9301) GN=mnmE PE=3 SV=1 79 573 2.0E-53
sp|Q46HI4|MNME_PROMT tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain NATL2A) GN=mnmE PE=3 SV=1 67 573 2.0E-53
sp|A2C018|MNME_PROM1 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain NATL1A) GN=mnmE PE=3 SV=1 67 573 3.0E-53
sp|Q87TS2|MNME_PSESM tRNA modification GTPase MnmE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mnmE PE=3 SV=1 69 573 3.0E-53
sp|A0PX77|MNME_CLONN tRNA modification GTPase MnmE OS=Clostridium novyi (strain NT) GN=mnmE PE=3 SV=1 69 573 3.0E-53
sp|B0TAB6|MNME_HELMI tRNA modification GTPase MnmE OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mnmE PE=3 SV=1 69 573 3.0E-53
sp|Q3K429|MNME_PSEPF tRNA modification GTPase MnmE OS=Pseudomonas fluorescens (strain Pf0-1) GN=mnmE PE=3 SV=1 69 573 4.0E-53
sp|A6TG09|MNME_KLEP7 tRNA modification GTPase MnmE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mnmE PE=3 SV=1 68 573 5.0E-53
sp|Q1GXL7|MNME_METFK tRNA modification GTPase MnmE OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mnmE PE=3 SV=1 69 573 6.0E-53
sp|Q28VZ6|MNME_JANSC tRNA modification GTPase MnmE OS=Jannaschia sp. (strain CCS1) GN=mnmE PE=3 SV=1 70 386 6.0E-53
sp|Q2Y5A9|MNME_NITMU tRNA modification GTPase MnmE OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=mnmE PE=3 SV=1 69 573 7.0E-53
sp|B2VCE7|MNME_ERWT9 tRNA modification GTPase MnmE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mnmE PE=3 SV=1 69 573 8.0E-53
sp|A1WDB4|MNME_ACISJ tRNA modification GTPase MnmE OS=Acidovorax sp. (strain JS42) GN=mnmE PE=3 SV=2 65 573 9.0E-53
sp|A8G2J5|MNME_PROM2 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9215) GN=mnmE PE=3 SV=1 79 573 1.0E-52
sp|B2A470|MNME_NATTJ tRNA modification GTPase MnmE OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=mnmE PE=3 SV=1 67 573 1.0E-52
sp|A8G7P7|MNME_SERP5 tRNA modification GTPase MnmE OS=Serratia proteamaculans (strain 568) GN=mnmE PE=3 SV=1 66 573 1.0E-52
sp|A6T4D6|MNME_JANMA tRNA modification GTPase MnmE OS=Janthinobacterium sp. (strain Marseille) GN=mnmE PE=3 SV=1 71 573 1.0E-52
sp|A7MN03|MNME_CROS8 tRNA modification GTPase MnmE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mnmE PE=3 SV=1 68 573 1.0E-52
sp|A2BNY4|MNME_PROMS tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain AS9601) GN=mnmE PE=3 SV=1 79 573 1.0E-52
sp|Q02DE1|MNME_PSEAB tRNA modification GTPase MnmE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mnmE PE=3 SV=1 66 573 1.0E-52
sp|Q8XH30|MNME_CLOPE tRNA modification GTPase MnmE OS=Clostridium perfringens (strain 13 / Type A) GN=mnmE PE=3 SV=1 69 573 2.0E-52
sp|Q0TLZ4|MNME_CLOP1 tRNA modification GTPase MnmE OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mnmE PE=3 SV=1 69 573 2.0E-52
sp|Q1I2H5|MNME_PSEE4 tRNA modification GTPase MnmE OS=Pseudomonas entomophila (strain L48) GN=mnmE PE=3 SV=1 69 573 2.0E-52
sp|Q3AG56|MNME_CARHZ tRNA modification GTPase MnmE OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mnmE PE=3 SV=1 68 573 2.0E-52
sp|Q0SPQ3|MNME_CLOPS tRNA modification GTPase MnmE OS=Clostridium perfringens (strain SM101 / Type A) GN=mnmE PE=3 SV=1 69 573 2.0E-52
sp|Q2KTI2|MNME_BORA1 tRNA modification GTPase MnmE OS=Bordetella avium (strain 197N) GN=mnmE PE=3 SV=1 71 573 2.0E-52
sp|Q6CYQ9|MNME_PECAS tRNA modification GTPase MnmE OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mnmE PE=3 SV=1 66 573 3.0E-52
sp|Q4ZL12|MNME_PSEU2 tRNA modification GTPase MnmE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mnmE PE=3 SV=1 69 573 3.0E-52
sp|Q7WDI4|MNME_BORBR tRNA modification GTPase MnmE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mnmE PE=3 SV=1 79 573 3.0E-52
sp|Q0HD65|MNME_SHESM tRNA modification GTPase MnmE OS=Shewanella sp. (strain MR-4) GN=mnmE PE=3 SV=1 69 573 3.0E-52
sp|Q7W2J0|MNME_BORPA tRNA modification GTPase MnmE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mnmE PE=3 SV=1 79 573 3.0E-52
sp|Q7VSR5|MNME_BORPE tRNA modification GTPase MnmE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mnmE PE=3 SV=1 79 573 4.0E-52
sp|Q9HT07|MNME_PSEAE tRNA modification GTPase MnmE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mnmE PE=3 SV=1 66 573 5.0E-52
sp|A5UID5|MNME_HAEIG tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain PittGG) GN=mnmE PE=3 SV=1 69 573 5.0E-52
sp|Q0HPE7|MNME_SHESR tRNA modification GTPase MnmE OS=Shewanella sp. (strain MR-7) GN=mnmE PE=3 SV=1 69 573 5.0E-52
sp|A3DHY8|MNME_CLOTH tRNA modification GTPase MnmE OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mnmE PE=3 SV=1 67 573 5.0E-52
sp|C6DK97|MNME_PECCP tRNA modification GTPase MnmE OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mnmE PE=3 SV=1 66 573 6.0E-52
sp|A5N451|MNME_CLOK5 tRNA modification GTPase MnmE OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mnmE PE=3 SV=1 69 573 6.0E-52
sp|A5G169|MNME_ACICJ tRNA modification GTPase MnmE OS=Acidiphilium cryptum (strain JF-5) GN=mnmE PE=3 SV=1 66 385 7.0E-52
sp|A0KR31|MNME_SHESA tRNA modification GTPase MnmE OS=Shewanella sp. (strain ANA-3) GN=mnmE PE=3 SV=1 69 573 7.0E-52
sp|Q48BF3|MNME_PSE14 tRNA modification GTPase MnmE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mnmE PE=3 SV=1 69 573 7.0E-52
sp|B1YGA8|MNME_EXIS2 tRNA modification GTPase MnmE OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mnmE PE=3 SV=1 69 573 7.0E-52
sp|A6LMN4|MNME_THEM4 tRNA modification GTPase MnmE OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mnmE PE=3 SV=1 69 573 7.0E-52
sp|Q6F6L1|MNME_ACIAD tRNA modification GTPase MnmE OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mnmE PE=3 SV=1 70 573 8.0E-52
sp|A9IJ97|MNME_BORPD tRNA modification GTPase MnmE OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=mnmE PE=3 SV=1 71 573 9.0E-52
sp|A7GVP7|MNME_BACCN tRNA modification GTPase MnmE OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mnmE PE=3 SV=1 69 573 1.0E-51
sp|Q31CZ2|MNME_PROM9 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9312) GN=mnmE PE=3 SV=1 79 573 2.0E-51
sp|Q8E5T7|MNME_STRA3 tRNA modification GTPase MnmE OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mnmE PE=3 SV=1 69 432 2.0E-51
sp|Q0I6N5|MNME_SYNS3 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain CC9311) GN=mnmE PE=3 SV=1 72 573 2.0E-51
sp|Q8CX13|MNME_STRA5 tRNA modification GTPase MnmE OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=mnmE PE=3 SV=1 69 432 2.0E-51
sp|Q3K1I2|MNME_STRA1 tRNA modification GTPase MnmE OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mnmE PE=3 SV=1 69 432 2.0E-51
sp|Q8CX54|MNME_OCEIH tRNA modification GTPase MnmE OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mnmE PE=3 SV=1 69 573 3.0E-51
sp|A1T0N0|MNME_PSYIN tRNA modification GTPase MnmE OS=Psychromonas ingrahamii (strain 37) GN=mnmE PE=3 SV=1 69 573 3.0E-51
sp|P0A176|MNME_PSEPU tRNA modification GTPase MnmE OS=Pseudomonas putida GN=mnmE PE=3 SV=1 69 573 4.0E-51
sp|P0A175|MNME_PSEPK tRNA modification GTPase MnmE OS=Pseudomonas putida (strain KT2440) GN=mnmE PE=3 SV=1 69 573 4.0E-51
sp|A5WBB6|MNME_PSEP1 tRNA modification GTPase MnmE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mnmE PE=3 SV=1 69 573 4.0E-51
sp|Q30YQ7|MNME_DESAG tRNA modification GTPase MnmE OS=Desulfovibrio alaskensis (strain G20) GN=mnmE PE=3 SV=1 69 573 4.0E-51
sp|Q8R6K8|MNME_CALS4 tRNA modification GTPase MnmE OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mnmE PE=3 SV=1 69 573 4.0E-51
sp|Q21QM5|MNME_RHOFT tRNA modification GTPase MnmE OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mnmE PE=3 SV=1 65 573 5.0E-51
sp|A4STS4|MNME_AERS4 tRNA modification GTPase MnmE OS=Aeromonas salmonicida (strain A449) GN=mnmE PE=3 SV=1 67 573 6.0E-51
sp|A5UD71|MNME_HAEIE tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain PittEE) GN=mnmE PE=3 SV=1 69 573 7.0E-51
sp|B0JVV0|MNME_MICAN tRNA modification GTPase MnmE OS=Microcystis aeruginosa (strain NIES-843) GN=mnmE PE=3 SV=1 69 573 8.0E-51
sp|Q4QLQ9|MNME_HAEI8 tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain 86-028NP) GN=mnmE PE=3 SV=1 69 573 9.0E-51
sp|P43730|MNME_HAEIN tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mnmE PE=3 SV=2 69 573 1.0E-50
sp|A8MKR9|MNME_ALKOO tRNA modification GTPase MnmE OS=Alkaliphilus oremlandii (strain OhILAs) GN=mnmE PE=3 SV=1 68 430 1.0E-50
sp|Q9KVY5|MNME_VIBCH tRNA modification GTPase MnmE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mnmE PE=3 SV=2 69 573 1.0E-50
sp|B1KUB2|MNME_CLOBM tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mnmE PE=3 SV=1 69 573 1.0E-50
sp|A1U7J3|MNME_MARHV tRNA modification GTPase MnmE OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mnmE PE=3 SV=1 64 573 1.0E-50
sp|A5F485|MNME_VIBC3 tRNA modification GTPase MnmE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mnmE PE=3 SV=2 69 573 1.0E-50
sp|A0AMD2|MNME_LISW6 tRNA modification GTPase MnmE OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mnmE PE=3 SV=1 69 437 1.0E-50
sp|B0KRC0|MNME_PSEPG tRNA modification GTPase MnmE OS=Pseudomonas putida (strain GB-1) GN=mnmE PE=3 SV=1 69 573 1.0E-50
sp|A1RQE8|MNME_SHESW tRNA modification GTPase MnmE OS=Shewanella sp. (strain W3-18-1) GN=mnmE PE=3 SV=1 69 573 2.0E-50
sp|A4VWD1|MNME_STRSY tRNA modification GTPase MnmE OS=Streptococcus suis (strain 05ZYH33) GN=mnmE PE=3 SV=1 69 432 2.0E-50
sp|A4W2N6|MNME_STRS2 tRNA modification GTPase MnmE OS=Streptococcus suis (strain 98HAH33) GN=mnmE PE=3 SV=1 69 432 2.0E-50
sp|A4YCM1|MNME_SHEPC tRNA modification GTPase MnmE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=mnmE PE=3 SV=1 69 573 2.0E-50
sp|Q814F6|MNME_BACCR tRNA modification GTPase MnmE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mnmE PE=3 SV=1 69 444 3.0E-50
sp|B1JFV3|MNME_PSEPW tRNA modification GTPase MnmE OS=Pseudomonas putida (strain W619) GN=mnmE PE=3 SV=1 69 573 3.0E-50
sp|A9KLX9|MNME_CLOPH tRNA modification GTPase MnmE OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mnmE PE=3 SV=1 69 573 3.0E-50
sp|Q5E8Z9|MNME_VIBF1 tRNA modification GTPase MnmE OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mnmE PE=3 SV=1 69 573 3.0E-50
sp|A1S1G4|MNME_SHEAM tRNA modification GTPase MnmE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mnmE PE=3 SV=1 69 573 3.0E-50
sp|Q11TG8|MNME_CYTH3 tRNA modification GTPase MnmE OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mnmE PE=3 SV=1 71 573 3.0E-50
sp|A1VUS4|MNME_POLNA tRNA modification GTPase MnmE OS=Polaromonas naphthalenivorans (strain CJ2) GN=mnmE PE=3 SV=1 71 573 3.0E-50
sp|A5CY46|MNME_PELTS tRNA modification GTPase MnmE OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mnmE PE=3 SV=1 68 573 3.0E-50
sp|Q3ANQ3|MNME_CHLCH tRNA modification GTPase MnmE OS=Chlorobium chlorochromatii (strain CaD3) GN=mnmE PE=3 SV=1 68 573 4.0E-50
sp|B0K8H9|MNME_THEP3 tRNA modification GTPase MnmE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mnmE PE=3 SV=1 69 573 4.0E-50
sp|B0K5N4|MNME_THEPX tRNA modification GTPase MnmE OS=Thermoanaerobacter sp. (strain X514) GN=mnmE PE=3 SV=1 69 573 4.0E-50
sp|A7GJN9|MNME_CLOBL tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mnmE PE=3 SV=1 69 573 5.0E-50
sp|B1IHR9|MNME_CLOBK tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Okra / Type B1) GN=mnmE PE=3 SV=1 69 573 5.0E-50
sp|A5I816|MNME_CLOBH tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mnmE PE=3 SV=1 69 573 5.0E-50
sp|A7FPM0|MNME_CLOB1 tRNA modification GTPase MnmE OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mnmE PE=3 SV=1 69 573 5.0E-50
sp|A8AXP0|MNME_STRGC tRNA modification GTPase MnmE OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mnmE PE=3 SV=1 69 432 5.0E-50
sp|Q9WYA4|MNME_THEMA tRNA modification GTPase MnmE OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mnmE PE=1 SV=1 69 573 5.0E-50
sp|A0KQZ6|MNME_AERHH tRNA modification GTPase MnmE OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mnmE PE=3 SV=1 67 573 6.0E-50
sp|Q926U7|MNME_LISIN tRNA modification GTPase MnmE OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mnmE PE=3 SV=1 69 437 6.0E-50
sp|A6TXE5|MNME_ALKMQ tRNA modification GTPase MnmE OS=Alkaliphilus metalliredigens (strain QYMF) GN=mnmE PE=3 SV=1 68 573 7.0E-50
sp|Q8Y3H5|MNME_RALSO tRNA modification GTPase MnmE OS=Ralstonia solanacearum (strain GMI1000) GN=mnmE PE=3 SV=2 71 573 7.0E-50
sp|A0RLR2|MNME_BACAH tRNA modification GTPase MnmE OS=Bacillus thuringiensis (strain Al Hakam) GN=mnmE PE=3 SV=1 69 573 1.0E-49
sp|Q71VV0|MNME_LISMF tRNA modification GTPase MnmE OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mnmE PE=3 SV=1 69 437 1.0E-49
sp|P0C8P1|MNME_THEEB tRNA modification GTPase MnmE OS=Thermosynechococcus elongatus (strain BP-1) GN=mnmE PE=3 SV=1 69 573 1.0E-49
sp|P0C8N9|MNME_SYNEL tRNA modification GTPase MnmE OS=Synechococcus elongatus GN=mnmE PE=3 SV=1 69 573 1.0E-49
sp|Q1J6U1|MNME_STRPF tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=mnmE PE=3 SV=1 69 432 1.0E-49
sp|Q13SH7|MNME_BURXL tRNA modification GTPase MnmE OS=Burkholderia xenovorans (strain LB400) GN=mnmE PE=3 SV=1 69 573 1.0E-49
sp|Q5XCB7|MNME_STRP6 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mnmE PE=3 SV=1 69 432 1.0E-49
sp|Q48TS5|MNME_STRPM tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mnmE PE=3 SV=1 69 432 1.0E-49
sp|A6Q3D6|MNME_NITSB tRNA modification GTPase MnmE OS=Nitratiruptor sp. (strain SB155-2) GN=mnmE PE=3 SV=1 67 573 2.0E-49
sp|Q6LW56|MNME_PHOPR tRNA modification GTPase MnmE OS=Photobacterium profundum GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|Q0ATU5|MNME_SYNWW tRNA modification GTPase MnmE OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|Q44633|MNME_BUCAP tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mnmE PE=3 SV=1 68 425 2.0E-49
sp|A8YYS1|MNME_STAAT tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|A6QKK2|MNME_STAAE tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain Newman) GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|Q5HCI3|MNME_STAAC tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain COL) GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|Q2FDE8|MNME_STAA3 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain USA300) GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|Q65CN1|MNME_BACLD tRNA modification GTPase MnmE OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mnmE PE=3 SV=1 69 437 2.0E-49
sp|Q630B8|MNME_BACCZ tRNA modification GTPase MnmE OS=Bacillus cereus (strain ZK / E33L) GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|Q6HAF2|MNME_BACHK tRNA modification GTPase MnmE OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|Q81JD9|MNME_BACAN tRNA modification GTPase MnmE OS=Bacillus anthracis GN=mnmE PE=3 SV=1 69 573 2.0E-49
sp|A9VTM0|MNME_BACWK tRNA modification GTPase MnmE OS=Bacillus weihenstephanensis (strain KBAB4) GN=mnmE PE=3 SV=1 69 444 2.0E-49
sp|B0TYD1|MNME_FRAP2 tRNA modification GTPase MnmE OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mnmE PE=3 SV=1 67 387 2.0E-49
sp|A8F732|MNME_PSELT tRNA modification GTPase MnmE OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mnmE PE=3 SV=1 69 573 3.0E-49
sp|Q8CMN5|MNME_STAES tRNA modification GTPase MnmE OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mnmE PE=3 SV=1 69 573 3.0E-49
sp|Q5HS36|MNME_STAEQ tRNA modification GTPase MnmE OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mnmE PE=3 SV=1 69 573 3.0E-49
sp|B1L9N6|MNME_THESQ tRNA modification GTPase MnmE OS=Thermotoga sp. (strain RQ2) GN=mnmE PE=3 SV=1 69 573 3.0E-49
sp|Q1JLX3|MNME_STRPC tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mnmE PE=3 SV=1 69 432 3.0E-49
sp|A4XN51|MNME_CALS8 tRNA modification GTPase MnmE OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mnmE PE=3 SV=1 110 573 3.0E-49
sp|A4T0N1|MNME_POLSQ tRNA modification GTPase MnmE OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=mnmE PE=3 SV=1 71 573 3.0E-49
sp|Q72WU3|MNME_BACC1 tRNA modification GTPase MnmE OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mnmE PE=3 SV=1 69 573 3.0E-49
sp|Q1LH94|MNME_CUPMC tRNA modification GTPase MnmE OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=mnmE PE=3 SV=1 71 573 4.0E-49
sp|P0DG23|MNME_STRPQ tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mnmE PE=3 SV=1 69 432 4.0E-49
sp|P0DG22|MNME_STRP3 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mnmE PE=3 SV=1 69 432 4.0E-49
sp|Q1JH22|MNME_STRPD tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=mnmE PE=3 SV=1 69 432 4.0E-49
sp|Q8P161|MNME_STRP8 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mnmE PE=3 SV=1 69 432 4.0E-49
sp|Q39PQ9|MNME_GEOMG tRNA modification GTPase MnmE OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mnmE PE=3 SV=1 68 573 4.0E-49
sp|A9KX19|MNME_SHEB9 tRNA modification GTPase MnmE OS=Shewanella baltica (strain OS195) GN=mnmE PE=3 SV=1 69 573 4.0E-49
sp|Q8Y3M4|MNME_LISMO tRNA modification GTPase MnmE OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mnmE PE=3 SV=1 69 437 4.0E-49
sp|A2REM7|MNME_STRPG tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mnmE PE=3 SV=1 69 432 5.0E-49
sp|Q9RCA7|MNME_BACHD tRNA modification GTPase MnmE OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mnmE PE=3 SV=1 69 432 5.0E-49
sp|A6WUK3|MNME_SHEB8 tRNA modification GTPase MnmE OS=Shewanella baltica (strain OS185) GN=mnmE PE=3 SV=1 69 573 5.0E-49
sp|Q7U344|MNME_HAEDU tRNA modification GTPase MnmE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mnmE PE=3 SV=1 69 573 5.0E-49
sp|Q99ZU0|MNME_STRP1 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M1 GN=mnmE PE=3 SV=1 69 432 7.0E-49
sp|Q2LSF6|MNME_SYNAS tRNA modification GTPase MnmE OS=Syntrophus aciditrophicus (strain SB) GN=mnmE PE=3 SV=1 69 573 7.0E-49
sp|Q88RX5|MNME_LACPL tRNA modification GTPase MnmE OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mnmE PE=3 SV=1 69 573 7.0E-49
sp|Q4L2Z2|MNME_STAHJ tRNA modification GTPase MnmE OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mnmE PE=3 SV=1 69 573 8.0E-49
sp|B1KQ64|MNME_SHEWM tRNA modification GTPase MnmE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mnmE PE=3 SV=1 69 573 8.0E-49
sp|P97043|MNME_LEPIN tRNA modification GTPase MnmE OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mnmE PE=3 SV=3 68 573 8.0E-49
sp|A1AXR3|MNME_RUTMC tRNA modification GTPase MnmE OS=Ruthia magnifica subsp. Calyptogena magnifica GN=mnmE PE=3 SV=1 66 573 8.0E-49
sp|Q67J33|MNME_SYMTH tRNA modification GTPase MnmE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mnmE PE=3 SV=2 67 573 9.0E-49
sp|A6W3V0|MNME_MARMS tRNA modification GTPase MnmE OS=Marinomonas sp. (strain MWYL1) GN=mnmE PE=3 SV=1 69 573 1.0E-48
sp|Q2RFI8|MNME_MOOTA tRNA modification GTPase MnmE OS=Moorella thermoacetica (strain ATCC 39073) GN=mnmE PE=3 SV=1 68 573 1.0E-48
sp|A9M0N5|MNME_NEIM0 tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C (strain 053442) GN=mnmE PE=3 SV=1 70 392 1.0E-48
sp|Q9JWB7|MNME_NEIMA tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mnmE PE=3 SV=1 70 392 1.0E-48
sp|Q72VY6|MNME_LEPIC tRNA modification GTPase MnmE OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mnmE PE=3 SV=1 68 573 1.0E-48
sp|Q12HM9|MNME_SHEDO tRNA modification GTPase MnmE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mnmE PE=3 SV=2 69 573 1.0E-48
sp|Q7V395|MNME_PROMP tRNA modification GTPase MnmE OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=mnmE PE=3 SV=1 67 573 1.0E-48
sp|Q9JXL4|MNME_NEIMB tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup B (strain MC58) GN=mnmE PE=3 SV=1 70 392 1.0E-48
sp|A3CNB0|MNME_STRSV tRNA modification GTPase MnmE OS=Streptococcus sanguinis (strain SK36) GN=mnmE PE=3 SV=1 69 432 1.0E-48
sp|Q8CX52|MNME_SHEON tRNA modification GTPase MnmE OS=Shewanella oneidensis (strain MR-1) GN=mnmE PE=3 SV=2 67 573 2.0E-48
sp|Q72D51|MNME_DESVH tRNA modification GTPase MnmE OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mnmE PE=3 SV=1 68 573 2.0E-48
sp|Q5QZJ5|MNME_IDILO tRNA modification GTPase MnmE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mnmE PE=3 SV=1 68 573 2.0E-48
sp|Q5FHQ5|MNME_LACAC tRNA modification GTPase MnmE OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mnmE PE=3 SV=1 69 573 2.0E-48
sp|A1KW66|MNME_NEIMF tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mnmE PE=3 SV=1 70 392 2.0E-48
sp|Q2NQ72|MNME_SODGM tRNA modification GTPase MnmE OS=Sodalis glossinidius (strain morsitans) GN=mnmE PE=3 SV=1 69 386 2.0E-48
sp|A8YTQ7|MNME_LACH4 tRNA modification GTPase MnmE OS=Lactobacillus helveticus (strain DPC 4571) GN=mnmE PE=3 SV=1 69 573 2.0E-48
sp|A1VER5|MNME_DESVV tRNA modification GTPase MnmE OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mnmE PE=3 SV=1 68 573 2.0E-48
sp|Q3IK56|MNME_PSEHT tRNA modification GTPase MnmE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mnmE PE=3 SV=1 67 573 2.0E-48
sp|Q9CLQ1|MNME_PASMU tRNA modification GTPase MnmE OS=Pasteurella multocida (strain Pm70) GN=mnmE PE=3 SV=1 69 573 3.0E-48
sp|Q602M5|MNME_METCA tRNA modification GTPase MnmE OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mnmE PE=3 SV=1 69 395 3.0E-48
sp|A2RP37|MNME_LACLM tRNA modification GTPase MnmE OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mnmE PE=3 SV=1 69 432 3.0E-48
sp|A5EY43|MNME_DICNV tRNA modification GTPase MnmE OS=Dichelobacter nodosus (strain VCS1703A) GN=mnmE PE=3 SV=1 67 573 4.0E-48
sp|Q746Q3|MNME_GEOSL tRNA modification GTPase MnmE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mnmE PE=3 SV=1 68 573 4.0E-48
sp|Q5P4P5|MNME_AROAE tRNA modification GTPase MnmE OS=Aromatoleum aromaticum (strain EbN1) GN=mnmE PE=3 SV=1 65 573 4.0E-48
sp|Q8DTT8|MNME_STRMU tRNA modification GTPase MnmE OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mnmE PE=3 SV=1 69 432 4.0E-48
sp|A3DAS7|MNME_SHEB5 tRNA modification GTPase MnmE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mnmE PE=3 SV=2 69 573 5.0E-48
sp|Q899S2|MNME_CLOTE tRNA modification GTPase MnmE OS=Clostridium tetani (strain Massachusetts / E88) GN=mnmE PE=3 SV=1 69 573 5.0E-48
sp|Q7MVZ2|MNME_PORGI tRNA modification GTPase MnmE OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=mnmE PE=3 SV=2 67 573 6.0E-48
sp|Q07VS7|MNME_SHEFN tRNA modification GTPase MnmE OS=Shewanella frigidimarina (strain NCIMB 400) GN=mnmE PE=3 SV=1 69 573 6.0E-48
sp|Q47U36|MNME_COLP3 tRNA modification GTPase MnmE OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mnmE PE=3 SV=1 79 573 7.0E-48
sp|A8FJG0|MNME_BACP2 tRNA modification GTPase MnmE OS=Bacillus pumilus (strain SAFR-032) GN=mnmE PE=3 SV=1 69 434 7.0E-48
sp|Q38UE9|MNME_LACSS tRNA modification GTPase MnmE OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mnmE PE=3 SV=1 69 573 8.0E-48
sp|Q9CDH8|MNME_LACLA tRNA modification GTPase MnmE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mnmE PE=3 SV=1 69 427 8.0E-48
sp|C1D6H7|MNME_LARHH tRNA modification GTPase MnmE OS=Laribacter hongkongensis (strain HLHK9) GN=mnmE PE=3 SV=1 79 573 9.0E-48
sp|A7N0X8|MNME_VIBCB tRNA modification GTPase MnmE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mnmE PE=3 SV=1 69 573 9.0E-48
sp|Q02VP7|MNME_LACLS tRNA modification GTPase MnmE OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mnmE PE=3 SV=1 69 432 1.0E-47
sp|Q8RHA2|MNME_FUSNN tRNA modification GTPase MnmE OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=mnmE PE=3 SV=1 69 573 1.0E-47
sp|A4ITX1|MNME_GEOTN tRNA modification GTPase MnmE OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mnmE PE=3 SV=1 69 573 1.0E-47
sp|A5VA82|MNME_SPHWW tRNA modification GTPase MnmE OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mnmE PE=3 SV=1 53 386 1.0E-47
sp|B4RRB9|MNME_NEIG2 tRNA modification GTPase MnmE OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mnmE PE=3 SV=1 70 392 1.0E-47
sp|Q5F529|MNME_NEIG1 tRNA modification GTPase MnmE OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mnmE PE=3 SV=1 70 392 1.0E-47
sp|Q033L0|MNME_LACC3 tRNA modification GTPase MnmE OS=Lactobacillus casei (strain ATCC 334) GN=mnmE PE=3 SV=1 69 573 2.0E-47
sp|Q0I0Z2|MNME_HAES1 tRNA modification GTPase MnmE OS=Haemophilus somnus (strain 129Pt) GN=mnmE PE=3 SV=1 67 573 2.0E-47
sp|Q7VE01|MNME_PROMA tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mnmE PE=3 SV=1 66 573 2.0E-47
sp|A7ZAW1|MNME_BACMF tRNA modification GTPase MnmE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mnmE PE=3 SV=1 69 423 2.0E-47
sp|P25811|MNME_BACSU tRNA modification GTPase MnmE OS=Bacillus subtilis (strain 168) GN=mnmE PE=3 SV=1 69 423 3.0E-47
sp|Q87TR6|MNME_VIBPA tRNA modification GTPase MnmE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mnmE PE=3 SV=1 69 573 3.0E-47
sp|P59569|MNME_BUCBP tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mnmE PE=3 SV=1 68 573 3.0E-47
sp|Q03KR8|MNME_STRTD tRNA modification GTPase MnmE OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mnmE PE=3 SV=1 69 423 3.0E-47
sp|Q5LZW3|MNME_STRT1 tRNA modification GTPase MnmE OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mnmE PE=3 SV=1 69 423 3.0E-47
sp|Q7MQK6|MNME_VIBVY tRNA modification GTPase MnmE OS=Vibrio vulnificus (strain YJ016) GN=mnmE PE=3 SV=2 69 573 4.0E-47
sp|Q5M4H3|MNME_STRT2 tRNA modification GTPase MnmE OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mnmE PE=3 SV=1 69 423 4.0E-47
sp|A5CVJ3|MNME_VESOH tRNA modification GTPase MnmE OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=mnmE PE=3 SV=1 66 386 4.0E-47
sp|P66973|MNME_STAAW tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain MW2) GN=mnmE PE=3 SV=1 69 573 5.0E-47
sp|Q6GD92|MNME_STAAR tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain MRSA252) GN=mnmE PE=3 SV=1 69 573 5.0E-47
sp|P66972|MNME_STAAN tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain N315) GN=mnmE PE=3 SV=1 69 573 5.0E-47
sp|A5IWD7|MNME_STAA9 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain JH9) GN=mnmE PE=3 SV=1 69 573 5.0E-47
sp|Q2FUQ2|MNME_STAA8 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain NCTC 8325) GN=mnmE PE=3 SV=1 69 573 5.0E-47
sp|A6U595|MNME_STAA2 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain JH1) GN=mnmE PE=3 SV=1 69 573 5.0E-47
sp|Q0VKU8|MNME_ALCBS tRNA modification GTPase MnmE OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mnmE PE=3 SV=1 66 573 5.0E-47
sp|Q1Q7V4|MNME_PSYCK tRNA modification GTPase MnmE OS=Psychrobacter cryohalolentis (strain K5) GN=mnmE PE=3 SV=2 53 573 5.0E-47
sp|Q15MS9|MNME_PSEA6 tRNA modification GTPase MnmE OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mnmE PE=3 SV=1 69 573 6.0E-47
sp|Q820T0|MNME_ENTFA tRNA modification GTPase MnmE OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mnmE PE=3 SV=1 69 423 6.0E-47
sp|Q8DPZ8|MNME_STRR6 tRNA modification GTPase MnmE OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=mnmE PE=3 SV=2 69 432 7.0E-47
sp|Q04KR8|MNME_STRP2 tRNA modification GTPase MnmE OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mnmE PE=3 SV=1 69 432 7.0E-47
sp|A6VF44|MNME_PSEA7 tRNA modification GTPase MnmE OS=Pseudomonas aeruginosa (strain PA7) GN=mnmE PE=3 SV=1 79 573 7.0E-47
sp|A5IXJ1|MNME_MYCAP tRNA modification GTPase MnmE OS=Mycoplasma agalactiae (strain PG2) GN=mnmE PE=3 SV=1 68 573 8.0E-47
sp|B1IBH5|MNME_STRPI tRNA modification GTPase MnmE OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mnmE PE=3 SV=1 69 432 8.0E-47
sp|B0BR82|MNME_ACTPJ tRNA modification GTPase MnmE OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mnmE PE=3 SV=1 69 573 8.0E-47
sp|Q6G5W4|MNME_STAAS tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain MSSA476) GN=mnmE PE=3 SV=1 69 573 9.0E-47
sp|Q2YZB8|MNME_STAAB tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mnmE PE=3 SV=1 69 573 1.0E-46
sp|Q1LTV8|MNME_BAUCH tRNA modification GTPase MnmE OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=mnmE PE=3 SV=1 69 573 1.0E-46
sp|O51830|MNME_BUCMP tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Myzus persicae GN=mnmE PE=3 SV=1 69 573 1.0E-46
sp|B1HPM3|MNME_LYSSC tRNA modification GTPase MnmE OS=Lysinibacillus sphaericus (strain C3-41) GN=mnmE PE=3 SV=1 69 437 1.0E-46
sp|A3QJT0|MNME_SHELP tRNA modification GTPase MnmE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mnmE PE=3 SV=1 69 573 1.0E-46
sp|Q9RL97|MNME_STRAG tRNA modification GTPase MnmE OS=Streptococcus agalactiae GN=mnmE PE=3 SV=1 69 432 1.0E-46
sp|A3N2D8|MNME_ACTP2 tRNA modification GTPase MnmE OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=mnmE PE=3 SV=1 69 573 1.0E-46
sp|Q2NX54|MNME_XANOM tRNA modification GTPase MnmE OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mnmE PE=3 SV=1 66 573 1.0E-46
sp|Q8DDI1|MNME_VIBVU tRNA modification GTPase MnmE OS=Vibrio vulnificus (strain CMCP6) GN=mnmE PE=3 SV=1 69 573 1.0E-46
sp|Q047F9|MNME_LACDB tRNA modification GTPase MnmE OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mnmE PE=3 SV=1 63 573 2.0E-46
sp|Q1G7Z4|MNME_LACDA tRNA modification GTPase MnmE OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mnmE PE=3 SV=1 63 573 2.0E-46
sp|A6QAL0|MNME_SULNB tRNA modification GTPase MnmE OS=Sulfurovum sp. (strain NBC37-1) GN=mnmE PE=3 SV=1 69 573 2.0E-46
sp|A1WSU0|MNME_VEREI tRNA modification GTPase MnmE OS=Verminephrobacter eiseniae (strain EF01-2) GN=mnmE PE=3 SV=1 69 573 2.0E-46
sp|Q85FG3|MNME_CYAME Probable tRNA modification GTPase MnmE OS=Cyanidioschyzon merolae GN=mnmE PE=3 SV=1 69 573 2.0E-46
sp|Q46VM0|MNME_CUPPJ tRNA modification GTPase MnmE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mnmE PE=3 SV=1 71 573 2.0E-46
sp|Q97R24|MNME_STRPN tRNA modification GTPase MnmE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=mnmE PE=3 SV=1 69 432 2.0E-46
sp|Q1GP64|MNME_SPHAL tRNA modification GTPase MnmE OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mnmE PE=3 SV=1 86 388 3.0E-46
sp|Q121L2|MNME_POLSJ tRNA modification GTPase MnmE OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=mnmE PE=3 SV=1 69 573 3.0E-46
sp|B0URU2|MNME_HISS2 tRNA modification GTPase MnmE OS=Histophilus somni (strain 2336) GN=mnmE PE=3 SV=1 67 573 3.0E-46
sp|A7GYZ1|MNME_CAMC5 tRNA modification GTPase MnmE OS=Campylobacter curvus (strain 525.92) GN=mnmE PE=3 SV=1 65 429 3.0E-46
sp|Q931E1|MNME_STAAM tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mnmE PE=3 SV=1 69 573 3.0E-46
sp|A7X7A8|MNME_STAA1 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mnmE PE=3 SV=1 69 573 3.0E-46
sp|Q040F3|MNME_LACGA tRNA modification GTPase MnmE OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mnmE PE=3 SV=1 69 573 4.0E-46
sp|A0KBN1|MNME_BURCH tRNA modification GTPase MnmE OS=Burkholderia cenocepacia (strain HI2424) GN=mnmE PE=3 SV=1 69 573 4.0E-46
sp|Q1BSF9|MNME_BURCA tRNA modification GTPase MnmE OS=Burkholderia cenocepacia (strain AU 1054) GN=mnmE PE=3 SV=1 69 573 4.0E-46
sp|Q3AGU7|MNME_SYNSC tRNA modification GTPase MnmE OS=Synechococcus sp. (strain CC9605) GN=mnmE PE=3 SV=1 79 386 4.0E-46
sp|Q04XE4|MNME_LEPBL tRNA modification GTPase MnmE OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mnmE PE=3 SV=1 68 573 5.0E-46
sp|Q04W28|MNME_LEPBJ tRNA modification GTPase MnmE OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mnmE PE=3 SV=1 68 573 5.0E-46
sp|Q5GTT5|MNME_XANOR tRNA modification GTPase MnmE OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mnmE PE=3 SV=2 66 573 5.0E-46
sp|Q181S7|MNME_PEPD6 tRNA modification GTPase MnmE OS=Peptoclostridium difficile (strain 630) GN=mnmE PE=3 SV=1 68 434 6.0E-46
sp|Q39BQ4|MNME_BURL3 tRNA modification GTPase MnmE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mnmE PE=3 SV=2 69 573 9.0E-46
sp|Q7M901|MNME_WOLSU tRNA modification GTPase MnmE OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=mnmE PE=3 SV=2 61 573 1.0E-45
sp|B0RMM4|MNME_XANCB tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. campestris (strain B100) GN=mnmE PE=3 SV=1 66 573 1.0E-45
sp|Q9RVL1|MNME_DEIRA tRNA modification GTPase MnmE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mnmE PE=3 SV=1 60 386 1.0E-45
sp|B2SUV8|MNME_XANOP tRNA modification GTPase MnmE OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mnmE PE=3 SV=1 66 573 1.0E-45
sp|Q03N64|MNME_LACBA tRNA modification GTPase MnmE OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mnmE PE=3 SV=1 69 573 1.0E-45
sp|Q1QS99|MNME_CHRSD tRNA modification GTPase MnmE OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mnmE PE=3 SV=1 69 573 1.0E-45
sp|B1K0Y2|MNME_BURCC tRNA modification GTPase MnmE OS=Burkholderia cenocepacia (strain MC0-3) GN=mnmE PE=3 SV=1 69 573 2.0E-45
sp|Q0A4L6|MNME_ALKEH tRNA modification GTPase MnmE OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mnmE PE=3 SV=1 70 389 2.0E-45
sp|Q5ZR82|MNME_LEGPH tRNA modification GTPase MnmE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mnmE PE=3 SV=1 67 391 2.0E-45
sp|Q39ZT0|MNME_PELCD tRNA modification GTPase MnmE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mnmE PE=3 SV=2 67 573 2.0E-45
sp|A2SMI8|MNME_METPP tRNA modification GTPase MnmE OS=Methylibium petroleiphilum (strain PM1) GN=mnmE PE=3 SV=2 65 573 2.0E-45
sp|Q5WAG3|MNME_BACSK tRNA modification GTPase MnmE OS=Bacillus clausii (strain KSM-K16) GN=mnmE PE=3 SV=1 69 573 3.0E-45
sp|A5IIK3|MNME_LEGPC tRNA modification GTPase MnmE OS=Legionella pneumophila (strain Corby) GN=mnmE PE=3 SV=1 67 389 3.0E-45
sp|Q6APY7|MNME_DESPS tRNA modification GTPase MnmE OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=mnmE PE=3 SV=2 66 573 3.0E-45
sp|Q5WSF0|MNME_LEGPL tRNA modification GTPase MnmE OS=Legionella pneumophila (strain Lens) GN=mnmE PE=3 SV=1 67 389 3.0E-45
sp|Q4FPR8|MNME_PSYA2 tRNA modification GTPase MnmE OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=mnmE PE=3 SV=1 70 573 4.0E-45
sp|A6VQS6|MNME_ACTSZ tRNA modification GTPase MnmE OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mnmE PE=3 SV=1 69 573 4.0E-45
sp|Q8P340|MNME_XANCP tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mnmE PE=3 SV=1 70 573 4.0E-45
sp|Q4UNL0|MNME_XANC8 tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mnmE PE=3 SV=1 70 573 4.0E-45
sp|Q6MGL5|MNME_BDEBA tRNA modification GTPase MnmE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=mnmE PE=3 SV=1 57 444 4.0E-45
sp|Q0KFG6|MNME_CUPNH tRNA modification GTPase MnmE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=mnmE PE=3 SV=2 71 573 4.0E-45
sp|Q74H94|MNME_LACJO tRNA modification GTPase MnmE OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mnmE PE=3 SV=1 69 573 4.0E-45
sp|Q5X0M3|MNME_LEGPA tRNA modification GTPase MnmE OS=Legionella pneumophila (strain Paris) GN=mnmE PE=3 SV=1 67 389 4.0E-45
sp|A8HAH9|MNME_SHEPA tRNA modification GTPase MnmE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mnmE PE=3 SV=1 69 573 4.0E-45
sp|B0TQH0|MNME_SHEHH tRNA modification GTPase MnmE OS=Shewanella halifaxensis (strain HAW-EB4) GN=mnmE PE=3 SV=1 69 573 5.0E-45
sp|P57132|MNME_BUCAI tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mnmE PE=3 SV=1 68 573 5.0E-45
sp|Q8KAS1|MNME_CHLTE tRNA modification GTPase MnmE OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mnmE PE=1 SV=1 65 573 6.0E-45
sp|Q30T75|MNME_SULDN tRNA modification GTPase MnmE OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=mnmE PE=3 SV=1 67 432 7.0E-45
sp|A1BCU6|MNME_CHLPD tRNA modification GTPase MnmE OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mnmE PE=3 SV=1 69 573 8.0E-45
sp|Q058F5|MNME_BUCCC tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=mnmE PE=3 SV=1 108 573 1.0E-44
sp|A1KCP8|MNME_AZOSB tRNA modification GTPase MnmE OS=Azoarcus sp. (strain BH72) GN=mnmE PE=3 SV=1 61 424 1.0E-44
sp|A8FP41|MNME_SHESH tRNA modification GTPase MnmE OS=Shewanella sediminis (strain HAW-EB3) GN=mnmE PE=3 SV=1 69 386 2.0E-44
sp|Q6KH82|MNME_MYCMO tRNA modification GTPase MnmE OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=mnmE PE=3 SV=1 69 424 2.0E-44
sp|A9NE34|MNME_ACHLI tRNA modification GTPase MnmE OS=Acholeplasma laidlawii (strain PG-8A) GN=mnmE PE=3 SV=1 70 573 3.0E-44
sp|Q3MBM5|MNME_ANAVT tRNA modification GTPase MnmE OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mnmE PE=3 SV=1 70 573 3.0E-44
sp|A8Z5X0|MNME_SULMW tRNA modification GTPase MnmE OS=Sulcia muelleri (strain GWSS) GN=mnmE PE=3 SV=1 67 573 3.0E-44
sp|B1YQJ5|MNME_BURA4 tRNA modification GTPase MnmE OS=Burkholderia ambifaria (strain MC40-6) GN=mnmE PE=3 SV=1 69 573 3.0E-44
sp|Q1WVH7|MNME_LACS1 tRNA modification GTPase MnmE OS=Lactobacillus salivarius (strain UCC118) GN=mnmE PE=3 SV=1 65 573 3.0E-44
sp|A5G9V3|MNME_GEOUR tRNA modification GTPase MnmE OS=Geobacter uraniireducens (strain Rf4) GN=mnmE PE=3 SV=1 69 573 4.0E-44
sp|Q8YN91|MNME_NOSS1 tRNA modification GTPase MnmE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mnmE PE=1 SV=1 70 573 4.0E-44
sp|A5GPA1|MNME_SYNPW tRNA modification GTPase MnmE OS=Synechococcus sp. (strain WH7803) GN=mnmE PE=3 SV=1 79 423 6.0E-44
sp|A8EV95|MNME_ARCB4 tRNA modification GTPase MnmE OS=Arcobacter butzleri (strain RM4018) GN=mnmE PE=3 SV=1 68 426 6.0E-44
sp|Q0BAQ4|MNME_BURCM tRNA modification GTPase MnmE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mnmE PE=3 SV=2 69 573 7.0E-44
sp|Q1J154|MNME_DEIGD tRNA modification GTPase MnmE OS=Deinococcus geothermalis (strain DSM 11300) GN=mnmE PE=3 SV=1 64 386 1.0E-43
sp|A7ZCZ1|MNME_CAMC1 tRNA modification GTPase MnmE OS=Campylobacter concisus (strain 13826) GN=mnmE PE=3 SV=1 69 423 1.0E-43
sp|Q2STM2|MNME_BURTA tRNA modification GTPase MnmE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mnmE PE=3 SV=2 69 573 1.0E-43
sp|A5WI36|MNME_PSYWF tRNA modification GTPase MnmE OS=Psychrobacter sp. (strain PRwf-1) GN=mnmE PE=3 SV=1 70 573 1.0E-43
sp|Q5KU57|MNME_GEOKA tRNA modification GTPase MnmE OS=Geobacillus kaustophilus (strain HTA426) GN=mnmE PE=3 SV=1 69 573 1.0E-43
sp|Q98RJ5|MNME_MYCPU tRNA modification GTPase MnmE OS=Mycoplasma pulmonis (strain UAB CTIP) GN=mnmE PE=3 SV=1 69 573 2.0E-43
sp|Q2JSU8|MNME_SYNJA tRNA modification GTPase MnmE OS=Synechococcus sp. (strain JA-3-3Ab) GN=mnmE PE=3 SV=1 80 573 2.0E-43
sp|Q7U3V6|MNME_SYNPX tRNA modification GTPase MnmE OS=Synechococcus sp. (strain WH8102) GN=mnmE PE=3 SV=1 79 423 2.0E-43
sp|Q65VC3|MNME_MANSM tRNA modification GTPase MnmE OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mnmE PE=3 SV=1 67 390 3.0E-43
sp|Q2A342|MNME_FRATH tRNA modification GTPase MnmE OS=Francisella tularensis subsp. holarctica (strain LVS) GN=mnmE PE=3 SV=1 67 386 5.0E-43
sp|A7NCL5|MNME_FRATF tRNA modification GTPase MnmE OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=mnmE PE=3 SV=1 67 386 5.0E-43
sp|Q7V491|MNME_PROMM tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9313) GN=mnmE PE=3 SV=1 79 375 7.0E-43
sp|Q3BLZ9|MNME_XANC5 tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mnmE PE=3 SV=1 65 573 7.0E-43
sp|Q03D59|MNME_PEDPA tRNA modification GTPase MnmE OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mnmE PE=3 SV=1 69 432 8.0E-43
sp|Q5N638|MNME_SYNP6 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mnmE PE=3 SV=2 67 573 9.0E-43
sp|Q0BLL9|MNME_FRATO tRNA modification GTPase MnmE OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=mnmE PE=3 SV=1 67 386 9.0E-43
sp|A5GW82|MNME_SYNR3 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain RCC307) GN=mnmE PE=3 SV=1 85 394 1.0E-42
sp|Q2JIE6|MNME_SYNJB tRNA modification GTPase MnmE OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mnmE PE=3 SV=1 80 573 1.0E-42
sp|B1XKC3|MNME_SYNP2 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mnmE PE=3 SV=1 69 423 1.0E-42
sp|A2CDC4|MNME_PROM3 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9303) GN=mnmE PE=3 SV=1 79 375 1.0E-42
sp|Q8D3I9|MNME_WIGBR tRNA modification GTPase MnmE OS=Wigglesworthia glossinidia brevipalpis GN=mnmE PE=3 SV=1 69 573 1.0E-42
sp|Q2NIG1|MNME_AYWBP tRNA modification GTPase MnmE OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=mnmE PE=3 SV=1 69 573 1.0E-42
sp|Q6MFA3|MNME_PARUW tRNA modification GTPase MnmE OS=Protochlamydia amoebophila (strain UWE25) GN=mnmE PE=3 SV=1 69 573 1.0E-42
sp|Q8KPU2|MNME_SYNE7 tRNA modification GTPase MnmE OS=Synechococcus elongatus (strain PCC 7942) GN=mnmE PE=3 SV=3 67 573 2.0E-42
sp|A0RNG2|MNME_CAMFF tRNA modification GTPase MnmE OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=mnmE PE=3 SV=1 70 452 2.0E-42
sp|A4IX14|MNME_FRATW tRNA modification GTPase MnmE OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=mnmE PE=3 SV=1 67 386 2.0E-42
sp|Q7VJY2|MNME_HELHP tRNA modification GTPase MnmE OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=mnmE PE=3 SV=2 68 573 2.0E-42
sp|Q5NFF3|MNME_FRATT tRNA modification GTPase MnmE OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=mnmE PE=3 SV=1 67 386 2.0E-42
sp|Q14GV5|MNME_FRAT1 tRNA modification GTPase MnmE OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=mnmE PE=3 SV=1 67 386 2.0E-42
sp|A9BHZ7|MNME_PETMO tRNA modification GTPase MnmE OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mnmE PE=3 SV=1 68 573 3.0E-42
sp|A4JJ44|MNME_BURVG tRNA modification GTPase MnmE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mnmE PE=3 SV=1 69 573 3.0E-42
sp|Q5SJS7|MNME_THET8 tRNA modification GTPase MnmE OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mnmE PE=3 SV=1 69 393 3.0E-42
sp|Q1CRH7|MNME_HELPH tRNA modification GTPase MnmE OS=Helicobacter pylori (strain HPAG1) GN=mnmE PE=3 SV=1 59 573 3.0E-42
sp|Q3B1B4|MNME_CHLL7 tRNA modification GTPase MnmE OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=mnmE PE=3 SV=1 68 573 3.0E-42
sp|Q49UI4|MNME_STAS1 tRNA modification GTPase MnmE OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mnmE PE=3 SV=2 69 573 5.0E-42
sp|A0LLH5|MNME_SYNFM tRNA modification GTPase MnmE OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mnmE PE=3 SV=1 133 573 5.0E-42
sp|B1ZWP5|MNME_OPITP tRNA modification GTPase MnmE OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=mnmE PE=3 SV=1 65 573 6.0E-42
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5064
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3194 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8015
Ophiocordyceps camponoti-rufipedis Ophun1|2492
Ophiocordyceps kimflemingae Ophio5|3324
Ophiocordyceps subramaniannii Hirsu2|2836

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3194
MLRRLARTQELACASRRSWGLVALAVHCRAPVPATTTTTTPAAARARSHYSWPSSSGPAASARRPASDDTIYALS
TAHGRAGIAVVRISGPSCLDVYRALCPLQKLPRPRYAALRSLHAPDKADPDADILDPQALVILFPGPRTVTGQDV
LELHLHGGPATVRAVLAAIARCPSPNRIRHAEPGEFTRRAFANGRLDLAQVEALGDALAAETEQQRRAAVRGNSG
ALGRTYELWRHQLLLARGEMEALIDFSEDQHFDEHPAHLLANVAHQVRTIVHSIHLHQLGGQRSELVRAGIRIAL
LGPPNVGKSSLMNLIVGRQASIVSGEAGTTRDVVEANLDLHGFLCCFADTAGFRSIDSANALGVVEAEGIKRARQ
KAQESDIILVLASIERGQSGPFVYYDEEALQLAAAAEKCLVLVNKRDMVDQITLSKLLQAFGATLAQTSKKLVAA
PLHVICCRQGEQTPSNGADASGVESLAVALVDVFSNMTKMPPGLEDALGVTVRQSQLLGKCRQHLEDFAAEAHSD
EGFGGDIVLAAEHLRYAADSLARLTGRGEAGDVEDVLGVVFEKFCVGK*
Coding >OphauG2|3194
ATGCTTCGGCGCTTGGCTCGGACGCAGGAATTGGCCTGCGCATCGCGGCGGAGCTGGGGCCTCGTGGCTCTGGCT
GTCCATTGCCGTGCCCCTGTGCCAGCGACGACGACGACGACGACGCCGGCGGCGGCCAGGGCACGCAGCCATTAC
TCATGGCCGTCGTCATCTGGCCCCGCTGCGTCTGCACGCCGCCCAGCCTCGGACGACACCATCTATGCCCTGTCG
ACAGCCCATGGGCGAGCCGGAATCGCCGTGGTCCGTATTTCTGGGCCTTCGTGCCTTGATGTCTACCGTGCCCTG
TGCCCCCTCCAGAAGCTGCCCCGGCCCAGGTACGCGGCGCTACGCTCACTCCATGCCCCGGACAAGGCAGACCCA
GACGCAGACATTCTTGACCCCCAGGCCCTCGTCATCCTGTTTCCAGGGCCCCGGACCGTCACGGGCCAAGACGTC
TTGGAGCTGCATCTCCATGGCGGCCCAGCCACGGTGAGGGCTGTCTTGGCTGCCATTGCTCGCTGTCCATCCCCC
AACCGGATTCGCCATGCCGAGCCCGGCGAGTTCACCAGGCGCGCCTTTGCCAATGGCCGCCTGGACCTGGCCCAA
GTGGAAGCCCTGGGCGATGCCCTGGCAGCAGAGACGGAGCAGCAGCGCCGGGCGGCGGTCCGCGGCAACTCGGGC
GCCCTGGGACGCACTTACGAGCTGTGGCGTCACCAGCTGCTCCTGGCGCGCGGCGAGATGGAGGCCCTGATTGAC
TTTTCTGAGGACCAGCACTTTGACGAGCATCCGGCCCACCTGTTGGCCAATGTGGCGCATCAGGTTCGCACCATT
GTGCACTCGATTCACCTGCACCAACTCGGGGGCCAGAGGAGCGAGTTAGTCAGAGCAGGAATCCGCATTGCGCTG
TTGGGCCCCCCCAATGTTGGTAAAAGCTCGCTCATGAATCTCATTGTTGGCCGCCAAGCATCCATCGTGTCGGGC
GAGGCCGGCACCACTCGCGATGTCGTCGAGGCCAACCTGGACCTGCATGGCTTTCTTTGTTGCTTTGCTGATACG
GCCGGCTTCCGGTCCATCGACTCGGCCAATGCGCTTGGCGTAGTGGAAGCAGAGGGCATCAAGCGAGCCAGGCAG
AAAGCCCAAGAGTCAGACATCATCTTGGTCCTTGCGTCGATTGAGCGCGGCCAGTCTGGACCATTTGTGTATTAT
GACGAGGAAGCTCTGCAGCTGGCGGCAGCGGCTGAGAAGTGTCTCGTACTCGTCAACAAACGAGACATGGTGGAT
CAGATTACTCTGTCCAAGCTTCTCCAAGCCTTTGGCGCCACGCTTGCCCAAACAAGCAAAAAGCTAGTCGCTGCT
CCTCTACACGTGATATGCTGCCGCCAAGGCGAGCAGACGCCGTCCAATGGTGCAGACGCTAGCGGCGTCGAGAGC
TTGGCTGTTGCCCTGGTTGATGTTTTCTCAAACATGACCAAGATGCCACCTGGCCTTGAAGATGCCTTGGGCGTC
ACGGTGCGTCAAAGCCAATTGCTTGGCAAGTGTCGTCAGCATCTAGAAGACTTTGCCGCAGAGGCGCACTCGGAT
GAGGGCTTTGGTGGCGACATTGTCTTGGCAGCTGAACATTTGAGATATGCGGCCGATAGTCTTGCGCGGCTCACG
GGCAGGGGCGAAGCTGGAGATGTTGAGGATGTCCTGGGAGTTGTTTTTGAAAAGTTTTGCGTGGGCAAGTAA
Transcript >OphauG2|3194
ATGCTTCGGCGCTTGGCTCGGACGCAGGAATTGGCCTGCGCATCGCGGCGGAGCTGGGGCCTCGTGGCTCTGGCT
GTCCATTGCCGTGCCCCTGTGCCAGCGACGACGACGACGACGACGCCGGCGGCGGCCAGGGCACGCAGCCATTAC
TCATGGCCGTCGTCATCTGGCCCCGCTGCGTCTGCACGCCGCCCAGCCTCGGACGACACCATCTATGCCCTGTCG
ACAGCCCATGGGCGAGCCGGAATCGCCGTGGTCCGTATTTCTGGGCCTTCGTGCCTTGATGTCTACCGTGCCCTG
TGCCCCCTCCAGAAGCTGCCCCGGCCCAGGTACGCGGCGCTACGCTCACTCCATGCCCCGGACAAGGCAGACCCA
GACGCAGACATTCTTGACCCCCAGGCCCTCGTCATCCTGTTTCCAGGGCCCCGGACCGTCACGGGCCAAGACGTC
TTGGAGCTGCATCTCCATGGCGGCCCAGCCACGGTGAGGGCTGTCTTGGCTGCCATTGCTCGCTGTCCATCCCCC
AACCGGATTCGCCATGCCGAGCCCGGCGAGTTCACCAGGCGCGCCTTTGCCAATGGCCGCCTGGACCTGGCCCAA
GTGGAAGCCCTGGGCGATGCCCTGGCAGCAGAGACGGAGCAGCAGCGCCGGGCGGCGGTCCGCGGCAACTCGGGC
GCCCTGGGACGCACTTACGAGCTGTGGCGTCACCAGCTGCTCCTGGCGCGCGGCGAGATGGAGGCCCTGATTGAC
TTTTCTGAGGACCAGCACTTTGACGAGCATCCGGCCCACCTGTTGGCCAATGTGGCGCATCAGGTTCGCACCATT
GTGCACTCGATTCACCTGCACCAACTCGGGGGCCAGAGGAGCGAGTTAGTCAGAGCAGGAATCCGCATTGCGCTG
TTGGGCCCCCCCAATGTTGGTAAAAGCTCGCTCATGAATCTCATTGTTGGCCGCCAAGCATCCATCGTGTCGGGC
GAGGCCGGCACCACTCGCGATGTCGTCGAGGCCAACCTGGACCTGCATGGCTTTCTTTGTTGCTTTGCTGATACG
GCCGGCTTCCGGTCCATCGACTCGGCCAATGCGCTTGGCGTAGTGGAAGCAGAGGGCATCAAGCGAGCCAGGCAG
AAAGCCCAAGAGTCAGACATCATCTTGGTCCTTGCGTCGATTGAGCGCGGCCAGTCTGGACCATTTGTGTATTAT
GACGAGGAAGCTCTGCAGCTGGCGGCAGCGGCTGAGAAGTGTCTCGTACTCGTCAACAAACGAGACATGGTGGAT
CAGATTACTCTGTCCAAGCTTCTCCAAGCCTTTGGCGCCACGCTTGCCCAAACAAGCAAAAAGCTAGTCGCTGCT
CCTCTACACGTGATATGCTGCCGCCAAGGCGAGCAGACGCCGTCCAATGGTGCAGACGCTAGCGGCGTCGAGAGC
TTGGCTGTTGCCCTGGTTGATGTTTTCTCAAACATGACCAAGATGCCACCTGGCCTTGAAGATGCCTTGGGCGTC
ACGGTGCGTCAAAGCCAATTGCTTGGCAAGTGTCGTCAGCATCTAGAAGACTTTGCCGCAGAGGCGCACTCGGAT
GAGGGCTTTGGTGGCGACATTGTCTTGGCAGCTGAACATTTGAGATATGCGGCCGATAGTCTTGCGCGGCTCACG
GGCAGGGGCGAAGCTGGAGATGTTGAGGATGTCCTGGGAGTTGTTTTTGAAAAGTTTTGCGTGGGCAAGTAA
Gene >OphauG2|3194
ATGCTTCGGCGCTTGGCTCGGACGCAGGAATTGGCCTGCGCATCGCGGCGGAGCTGGGGCCTCGTGGCTCTGGCT
GTCCATTGCCGTGCCCCTGTGCCAGCGACGACGACGACGACGACGCCGGCGGCGGCCAGGGCACGCAGCCATTAC
TCATGGCCGTCGTCATCTGGCCCCGCTGCGTCTGCACGCCGCCCAGCCTCGGACGACACCATCTATGCCCTGTCG
ACAGCCCATGGGCGAGCCGGAATCGCCGTGGTCCGTATTTCTGGGCCTTCGTGCCTTGATGTGAGACATGGGCGT
TCGCCGCCGGACTGGCTCAGTGGCTGACGCCCTCTTCTTCTCTTACTCGTCGCCGCCGGCTTCAAGGTCTACCGT
GCCCTGTGCCCCCTCCAGAAGCTGCCCCGGCCCAGGTACGCGGCGCTACGCTCACTCCATGCCCCGGACAAGGCA
GACCCAGACGCAGACATTCTTGACCCCCAGGCCCTCGTCATCCTGTTTCCAGGGCCCCGGACCGTCACGGGCCAA
GACGTCTTGGAGCTGCATCTCCATGGCGGCCCAGCCACGGTGAGGGCTGTCTTGGCTGCCATTGCTCGCTGTCCA
TCCCCCAACCGGATTCGCCATGCCGAGCCCGGCGAGTTCACCAGGCGCGCCTTTGCCAATGGCCGCCTGGACCTG
GCCCAAGTGGAAGCCCTGGGCGATGCCCTGGCAGCAGAGACGGAGCAGCAGCGCCGGGCGGCGGTCCGCGGCAAC
TCGGGCGCCCTGGGACGCACTTACGAGCTGTGGCGTCACCAGCTGCTCCTGGCGCGCGGCGAGATGGAGGCCCTG
ATTGACTTTTCTGAGGACCAGCACTTTGACGAGCATCCGGCCCACCTGTTGGCCAATGTGGCGCATCAGGTTCGC
ACCATTGTGCACTCGATTCACCTGCACCAACTCGGGGGCCAGAGGAGCGAGTTAGTCAGAGCAGGAATCCGCATT
GCGCTGTTGGGCCCCCCCAATGTTGGTAAAAGCTCGCTCATGAATCTCATTGTTGGCCGCCAAGCATCCATCGTG
TCGGGCGAGGCCGGCACCACTCGCGATGTCGTCGAGGCCAACCTGGACCTGCATGGCTTTCTTTGTTGCTTTGCT
GATACGGCCGGCTTCCGGTCCATCGACTCGGCCAATGCGCTTGGCGTAGTGGAAGCAGAGGGCATCAAGCGAGCC
AGGCAGAAAGCCCAAGAGTCAGACATCATCTTGGTCCTTGCGTCGATTGAGCGCGGCCAGTCTGGACCATTTGTG
TATTATGACGAGGAAGCTCTGCAGCTGGCGGCAGCGGCTGAGAAGTGTCTCGTACTCGTCAACAAACGAGACATG
GTGGATCAGATTACTCTGTCCAAGCTTCTCCAAGCCTTTGGCGCCACGCTTGCCCAAACAAGCAAAAAGCTAGTC
GCTGCTCCTCTACACGTGATATGCTGCCGCCAAGGCGAGCAGACGCCGTCCAATGGTGCAGACGCTAGCGGCGTC
GAGAGCTTGGCTGTTGCCCTGGTTGATGTTTTCTCAAACATGACCAAGATGCCACCTGGCCTTGAAGATGCCTTG
GGCGTCACGGTGCGTCAAAGCCAATTGCTTGGCAAGTGTCGTCAGCATCTAGAAGACTTTGCCGCAGAGGCGCAC
TCGGATGAGGGCTTTGGTGGCGACATTGTCTTGGCAGCTGAACATTTGAGATATGCGGCCGATAGTCTTGCGCGG
CTCACGGGCAGGGGCGAAGCTGGAGATGTTGAGGATGTCCTGGGAGTTGTTTTTGAAAAGTGAGTAGAGTGAGTA
GACGTCGATGAGGAGACGTCCCCCGCCATTGGCCAATGCACTGGGAATGACTTTGGAAACAGGTTTTGCGTGGGC
AAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail