Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3185
Gene name
LocationContig_236:465..1854
Strand+
Gene length (bp)1389
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 12 242 2.0E-27
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 12 242 1.0E-23
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 19 282 2.0E-21
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 30 288 4.0E-16
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 12 241 6.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 12 242 2.0E-27
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 12 242 1.0E-23
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 19 282 2.0E-21
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 30 288 4.0E-16
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 12 241 6.0E-16
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 22 279 6.0E-15
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 12 279 1.0E-13
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 30 286 2.0E-13
sp|C3VEQ2|ZEP_ONCHC Zeaxanthin epoxidase, chloroplastic OS=Oncidium hybrid cultivar GN=ZEP PE=2 SV=1 8 259 2.0E-12
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 8 276 2.0E-11
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 8 259 6.0E-10
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 8 259 9.0E-08
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 23 259 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3185
MTFFFFFFFSAGSKSLLTLKDGQQVLADLVIGADGVHSKASQEVLGYSNKAVGPLAANCCYRFLIPAETLEQDAE
TRFWNKDCQGWARLMPDNDSKRRLVAYTCRNDTIHNFVAIFYDQHVPPDMREDWQANIPVSEVLDRFADYNPGLL
KVIGKAKEAKRWPLLYRPPIPFWHRARLGLVGDAAHPMLPHMGQGGAQGLEDGLVMGIVMHGASSVKDIEARLAI
YDKVRRNRASAVQILSNVGMDQAELVAQHLRPYLDSDDIPSDPLQVLRFTYGYNAVDAATKAMKEYDAGFELPPD
FFQSEVVGVPPAE*
Coding >OphauG2|3185
ATGACTTTTTTTTTTTTTTTTTTCTTCTCAGCTGGCAGCAAATCATTGCTCACGCTCAAGGACGGCCAACAGGTG
CTCGCCGACCTGGTGATTGGAGCCGACGGCGTGCACTCCAAGGCCTCGCAAGAGGTGCTGGGCTACAGCAACAAG
GCCGTGGGCCCGCTTGCTGCCAACTGCTGCTACCGCTTCCTCATCCCGGCCGAGACGCTCGAGCAAGACGCCGAG
ACGCGCTTCTGGAACAAGGACTGCCAGGGCTGGGCGCGGTTGATGCCGGACAACGATAGCAAGCGAAGGCTTGTG
GCCTATACATGCCGCAACGACACGATTCACAACTTTGTGGCCATCTTCTACGACCAACATGTTCCGCCCGACATG
CGTGAAGACTGGCAGGCCAACATCCCCGTCTCCGAAGTGCTTGACAGATTCGCCGACTACAACCCAGGCCTGCTC
AAAGTGATTGGCAAGGCAAAAGAAGCCAAGAGATGGCCGCTTCTCTACCGACCCCCGATTCCCTTTTGGCACCGC
GCCCGCCTGGGCCTCGTTGGCGATGCTGCTCATCCCATGCTCCCTCACATGGGCCAGGGAGGCGCCCAAGGGCTC
GAAGACGGCCTCGTCATGGGCATCGTCATGCACGGCGCCTCATCCGTCAAAGACATTGAGGCACGGCTGGCAATC
TACGACAAGGTTCGGCGCAATCGAGCTAGCGCCGTGCAGATCCTGAGCAACGTGGGCATGGACCAGGCCGAGCTG
GTCGCGCAACACCTGCGTCCCTATCTAGATTCGGATGACATTCCGTCTGATCCACTTCAAGTCCTGCGCTTCACC
TATGGCTACAATGCTGTCGATGCGGCAACCAAGGCTATGAAGGAGTACGACGCTGGCTTTGAGCTGCCCCCAGAC
TTTTTCCAGAGCGAGGTGGTGGGCGTGCCGCCCGCAGAGTAA
Transcript >OphauG2|3185
ATGACTTTTTTTTTTTTTTTTTTCTTCTCAGCTGGCAGCAAATCATTGCTCACGCTCAAGGACGGCCAACAGGTG
CTCGCCGACCTGGTGATTGGAGCCGACGGCGTGCACTCCAAGGCCTCGCAAGAGGTGCTGGGCTACAGCAACAAG
GCCGTGGGCCCGCTTGCTGCCAACTGCTGCTACCGCTTCCTCATCCCGGCCGAGACGCTCGAGCAAGACGCCGAG
ACGCGCTTCTGGAACAAGGACTGCCAGGGCTGGGCGCGGTTGATGCCGGACAACGATAGCAAGCGAAGGCTTGTG
GCCTATACATGCCGCAACGACACGATTCACAACTTTGTGGCCATCTTCTACGACCAACATGTTCCGCCCGACATG
CGTGAAGACTGGCAGGCCAACATCCCCGTCTCCGAAGTGCTTGACAGATTCGCCGACTACAACCCAGGCCTGCTC
AAAGTGATTGGCAAGGCAAAAGAAGCCAAGAGATGGCCGCTTCTCTACCGACCCCCGATTCCCTTTTGGCACCGC
GCCCGCCTGGGCCTCGTTGGCGATGCTGCTCATCCCATGCTCCCTCACATGGGCCAGGGAGGCGCCCAAGGGCTC
GAAGACGGCCTCGTCATGGGCATCGTCATGCACGGCGCCTCATCCGTCAAAGACATTGAGGCACGGCTGGCAATC
TACGACAAGGTTCGGCGCAATCGAGCTAGCGCCGTGCAGATCCTGAGCAACGTGGGCATGGACCAGGCCGAGCTG
GTCGCGCAACACCTGCGTCCCTATCTAGATTCGGATGACATTCCGTCTGATCCACTTCAAGTCCTGCGCTTCACC
TATGGCTACAATGCTGTCGATGCGGCAACCAAGGCTATGAAGGAGTACGACGCTGGCTTTGAGCTGCCCCCAGAC
TTTTTCCAGAGCGAGGTGGTGGGCGTGCCGCCCGCAGAGTAA
Gene >OphauG2|3185
ATGACTTTTTTTTTTTTTTTTTTCTTCTCAGCTGGCAGCAAATCATTGCGTTTTAGGCCTCCCATCTGACCCGGC
TTACAGGACGCTTCCACGCCGTCAGTCACGCTCAAGGACGGCCAACAGGTGCTCGCCGACCTGGTGATTGGAGCC
GACGGCGTGCACTCCAAGGCCTCGCAAGAGGTGCTGGGCTACAGCAACAAGGCCGTGGGCCCGCTTGCTGCCAAC
TGCTGCTACCGCTTCCTCATCCCGGCCGAGACGCTCGAGCAAGACGCCGAGACGCGCTTCTGGAACAAGGACTGC
CAGGGCTGGGCGCGGTTGATGCCGGACAACGATAGCAAGCGAAGGCTTGTGGCCTATACATGCCGCAAGTAGGTT
TTTTTTCTTTCTTTTTTCTTCTTTTTCTTTTTTTTTGGGGGGGGAGGGAGATGATGGAGCGGCCCGTTTCATGGC
CAAGGCTGACATTGTGTAGCGACACGATTCACAACTTTGTGGCCATCTTCTACGACCAACATGTTCCGCCCGACA
TGCGTGAAGGTGTGCTGCCTTGTTCACCAGTCTCGGCCTGCTTTTTCCCAAGCTGACATTGCATCCCGGCGCCCT
TGTCTAGACTGGCAGGCCAACATCCCCGTCTCCGAAGTGCTTGACAGATTCGCCGACTACAACCCAGGCCTGCTC
AAAGTGATTGGGTATGCCATTGTCGCAAGCTCTCCAGCTTTCCCACCTCCCGCTCTTCAGCTGACGCTTTTTTTT
TTTTTTTGCCCCCAACACAGCAAGGCAAAAGAAGCCAAGAGATGGCCGCTTCTCTACCGACCCCCGATTCCCTTT
TGGCACCGCGCCCGCCTGGGCCTCGTTGGCGATGCTGCTCATCCCATGCTCCCTCGTACGTCTCTTACAAAACGC
TCTCTCCCCCTCCCTTGTCCCCAAAACTAACTCGGCCGTCATCCCGCCAGACATGGGCCAGGGAGGCGCCCAAGG
GCTCGAAGACGGCCTCGTCATGGGCATCGTCATGCACGGCGCCTCATCCGTCAAAGACATTGAGGCACGGCTGGC
AATCTACGACAAGGTTCGGCGCAATCGAGCTAGCGCCGTGCAGATCCTGAGCAACGTGGGCATGGACCAGGCCGA
GCTGGTCGCGCAACACCTGCGTCCCTATCTAGATTCGGATGACATTCCGTGTAAGCATTGCTCACGTCTTTCAGA
CCTTGCTTTGTCTTTGTTTTCTTCTTCTAACCTCTTTTGCTAGCTGATCCACTTCAAGTCCTGCGCTTCACCTAT
GGCTACAATGCTGTCGATGCGGCAACCAAGGCTATGAAGGAGTACGACGCTGGCTTTGAGCTGCCCCCAGACTTT
TTCCAGAGCGAGGTGGTGGGCGTGCCGCCCGCAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail