Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3180
Gene name
LocationContig_235:8043..9403
Strand-
Gene length (bp)1360
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.2E-10 347 393
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 5.7E-08 347 388
PF13639 zf-RING_2 Ring finger domain 1.0E-06 347 389
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 1.7E-06 348 395
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 6.5E-06 348 388
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 8.9E-05 347 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87176|SLX8_SCHPO E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slx8 PE=1 SV=1 331 392 1.0E-09
sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 344 392 2.0E-08
sp|Q96GF1|RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens GN=RNF185 PE=1 SV=1 344 392 3.0E-08
sp|Q568Y3|RN185_RAT E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1 344 392 3.0E-08
sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 327 403 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87176|SLX8_SCHPO E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slx8 PE=1 SV=1 331 392 1.0E-09
sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 344 392 2.0E-08
sp|Q96GF1|RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens GN=RNF185 PE=1 SV=1 344 392 3.0E-08
sp|Q568Y3|RN185_RAT E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1 344 392 3.0E-08
sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 327 403 4.0E-08
sp|O35445|RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1 327 403 4.0E-08
sp|Q5ZIR9|RN185_CHICK E3 ubiquitin-protein ligase RNF185 OS=Gallus gallus GN=RNF185 PE=2 SV=1 345 392 5.0E-08
sp|Q5RFK9|RN185_PONAB E3 ubiquitin-protein ligase RNF185 OS=Pongo abelii GN=RNF185 PE=2 SV=1 344 392 5.0E-08
sp|Q99942|RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1 327 392 6.0E-08
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 347 392 1.0E-07
sp|Q6PC78|RN185_DANRE E3 ubiquitin-protein ligase RNF185 OS=Danio rerio GN=rnf185 PE=2 SV=1 344 392 1.0E-07
sp|Q09463|RNF5_CAEEL RING finger protein 5 OS=Caenorhabditis elegans GN=rnf-5 PE=1 SV=1 344 398 5.0E-07
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 347 392 8.0E-07
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 347 392 9.0E-07
sp|Q8GUK7|RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana GN=RMA3 PE=1 SV=1 344 392 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0097602 cullin family protein binding Yes
GO:0061630 ubiquitin protein ligase activity Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0046872 metal ion binding Yes
GO:0005680 anaphase-promoting complex Yes
GO:0008270 zinc ion binding Yes
GO:0004842 ubiquitin-protein transferase activity No
GO:0009987 cellular process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0032991 protein-containing complex No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0008152 metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0005575 cellular_component No
GO:1901565 organonitrogen compound catabolic process No
GO:0044238 primary metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0019538 protein metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0043167 ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0000151 ubiquitin ligase complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0005515 protein binding No
GO:1901575 organic substance catabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0010498 proteasomal protein catabolic process No
GO:0003824 catalytic activity No
GO:0043169 cation binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006508 proteolysis No
GO:1902494 catalytic complex No
GO:0030163 protein catabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0000152 nuclear ubiquitin ligase complex No
GO:1990234 transferase complex No
GO:0046914 transition metal ion binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0043170 macromolecule metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2254
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3180 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2627
Ophiocordyceps camponoti-floridani Ophcf2|01949
Ophiocordyceps camponoti-rufipedis Ophun1|3716
Ophiocordyceps kimflemingae Ophio5|5910
Ophiocordyceps subramaniannii Hirsu2|2923

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3180
MSTPSKSPTPRSRDRFAATPSPIVRSQWWSDLRLPQSSSPSPSPQRSRFRFAAFAPEASLGSALAAFDHSPLPQS
LSGEQQPYSAAALPSSTSGSSFSSEWSSDSTDGESSLFVSSLHLSRNQNNNTDVDEAYPQDDEDDDDDDDPLLAF
FANTDFSSPSTFPSFANLVAHDTSLSPQSSLHSSQSTTDQSTLAGSESDSSEDSAVQFVHTHGPFRSLNPLSRES
SLFVTDSDTIPSSQESTQTTVFDMPPRQMQNILNSPEPPSPDSNTNKRRRLDSNTGNPQNSTAPALVLPQRPSFT
NDLFSEDALGHDTQATPTIDLTVSAEAIEQQFSKPEPDKRIKLASFQCVICMDDVTALTVTHCGHLFCQQCLHSS
LHVEANRGNCPMCRTKIDTKPRVSYTSKTKGYWPLELKLMTVTKKGKRKANVIN*
Coding >OphauG2|3180
ATGTCGACGCCGTCCAAGTCTCCCACGCCGCGTTCACGGGACCGCTTCGCAGCCACTCCATCGCCCATTGTCCGG
AGCCAGTGGTGGTCCGACTTGCGCTTGCCTCAATCGTCGTCGCCGTCGCCGTCGCCGCAGCGTTCGCGTTTCCGC
TTTGCCGCCTTTGCCCCCGAAGCCTCCCTGGGCAGCGCCTTGGCCGCCTTTGACCATTCTCCCCTGCCTCAGTCT
TTGTCTGGCGAGCAGCAGCCGTATAGCGCAGCAGCCTTGCCATCTAGTACTTCGGGCTCTAGCTTCTCTAGCGAA
TGGAGCTCTGATAGCACTGACGGCGAATCGTCTCTCTTTGTCTCCTCGCTCCATCTCAGCCGAAACCAAAACAAC
AACACCGACGTCGACGAAGCATACCCACAAGACGACGAAGACGACGACGACGACGACGACCCGCTCCTTGCCTTT
TTTGCTAATACCGACTTTTCATCCCCCTCCACCTTTCCCTCCTTTGCCAACCTGGTTGCCCATGACACATCCCTT
TCGCCACAGTCGTCGTTGCATTCGAGCCAAAGCACCACAGACCAATCAACACTTGCAGGCAGCGAGTCAGACTCG
AGTGAAGACTCTGCCGTGCAATTTGTCCACACCCACGGCCCCTTTAGATCCTTGAATCCTCTATCTAGAGAGTCA
TCGCTTTTTGTCACCGACTCTGACACCATTCCATCCTCGCAAGAATCGACGCAAACCACCGTTTTCGACATGCCG
CCTCGTCAAATGCAAAATATCCTCAACTCACCGGAGCCACCATCACCTGATTCAAATACAAACAAAAGGCGCCGC
CTTGATTCCAACACGGGCAACCCTCAAAATTCAACCGCACCGGCTCTGGTTCTGCCTCAGCGACCGTCCTTTACC
AATGACCTCTTTTCCGAGGACGCTCTTGGTCATGATACTCAGGCCACGCCAACCATCGATCTCACAGTGTCGGCT
GAAGCCATAGAACAGCAATTTAGCAAGCCTGAGCCGGACAAGCGAATCAAGCTGGCTTCCTTTCAGTGCGTCATT
TGCATGGACGACGTCACGGCACTTACCGTCACACACTGTGGTCATCTCTTTTGCCAGCAATGCCTTCACTCGTCG
CTCCACGTCGAGGCGAATCGCGGCAACTGCCCCATGTGCCGCACAAAAATTGATACCAAGCCCCGTGTTTCTTAC
ACCTCCAAGACAAAGGGATACTGGCCTCTGGAACTCAAGCTCATGACAGTGACAAAGAAGGGCAAGCGCAAGGCC
AATGTGATAAACTAA
Transcript >OphauG2|3180
ATGTCGACGCCGTCCAAGTCTCCCACGCCGCGTTCACGGGACCGCTTCGCAGCCACTCCATCGCCCATTGTCCGG
AGCCAGTGGTGGTCCGACTTGCGCTTGCCTCAATCGTCGTCGCCGTCGCCGTCGCCGCAGCGTTCGCGTTTCCGC
TTTGCCGCCTTTGCCCCCGAAGCCTCCCTGGGCAGCGCCTTGGCCGCCTTTGACCATTCTCCCCTGCCTCAGTCT
TTGTCTGGCGAGCAGCAGCCGTATAGCGCAGCAGCCTTGCCATCTAGTACTTCGGGCTCTAGCTTCTCTAGCGAA
TGGAGCTCTGATAGCACTGACGGCGAATCGTCTCTCTTTGTCTCCTCGCTCCATCTCAGCCGAAACCAAAACAAC
AACACCGACGTCGACGAAGCATACCCACAAGACGACGAAGACGACGACGACGACGACGACCCGCTCCTTGCCTTT
TTTGCTAATACCGACTTTTCATCCCCCTCCACCTTTCCCTCCTTTGCCAACCTGGTTGCCCATGACACATCCCTT
TCGCCACAGTCGTCGTTGCATTCGAGCCAAAGCACCACAGACCAATCAACACTTGCAGGCAGCGAGTCAGACTCG
AGTGAAGACTCTGCCGTGCAATTTGTCCACACCCACGGCCCCTTTAGATCCTTGAATCCTCTATCTAGAGAGTCA
TCGCTTTTTGTCACCGACTCTGACACCATTCCATCCTCGCAAGAATCGACGCAAACCACCGTTTTCGACATGCCG
CCTCGTCAAATGCAAAATATCCTCAACTCACCGGAGCCACCATCACCTGATTCAAATACAAACAAAAGGCGCCGC
CTTGATTCCAACACGGGCAACCCTCAAAATTCAACCGCACCGGCTCTGGTTCTGCCTCAGCGACCGTCCTTTACC
AATGACCTCTTTTCCGAGGACGCTCTTGGTCATGATACTCAGGCCACGCCAACCATCGATCTCACAGTGTCGGCT
GAAGCCATAGAACAGCAATTTAGCAAGCCTGAGCCGGACAAGCGAATCAAGCTGGCTTCCTTTCAGTGCGTCATT
TGCATGGACGACGTCACGGCACTTACCGTCACACACTGTGGTCATCTCTTTTGCCAGCAATGCCTTCACTCGTCG
CTCCACGTCGAGGCGAATCGCGGCAACTGCCCCATGTGCCGCACAAAAATTGATACCAAGCCCCGTGTTTCTTAC
ACCTCCAAGACAAAGGGATACTGGCCTCTGGAACTCAAGCTCATGACAGTGACAAAGAAGGGCAAGCGCAAGGCC
AATGTGATAAACTAA
Gene >OphauG2|3180
ATGTCGACGCCGTCCAAGTCTCCCACGCCGCGTTCACGGGACCGCTTCGCAGCCACTCCATCGCCCATTGTCCGG
AGCCAGTGGTGGTCCGACTTGCGCTTGCCTCAATCGTCGTCGCCGTCGCCGTCGCCGCAGCGTTCGCGTTTCCGC
TTTGCCGCCTTTGCCCCCGAAGCCTCCCTGGGCAGCGCCTTGGCCGCCTTTGACCATTCTCCCCTGCCTCAGTCT
TTGTCTGGCGAGCAGCAGCCGTATAGCGCAGCAGCCTTGCCATCTAGTACTTCGGGCTCTAGCTTCTCTAGCGAA
TGGAGCTCTGATAGCACTGACGGCGAATCGTCTCTCTTTGTCTCCTCGCTCCATCTCAGCCGAAACCAAAACAAC
AACACCGACGTCGACGAAGCATACCCACAAGACGACGAAGACGACGACGACGACGACGACCCGCTCCTTGCCTTT
TTTGCTAATACCGACTTTTCATCCCCCTCCACCTTTCCCTCCTTTGCCAACCTGGTTGCCCATGACACATCCCTT
TCGCCACAGTCGTCGTTGCATTCGAGCCAAAGCACCACAGACCAATCAACACTTGCAGGCAGCGAGTCAGACTCG
AGTGAAGACTCTGCCGTGCAATTTGTCCACACCCACGGCCCCTTTAGATCCTTGAATCCTCTATCTAGAGAGTCA
TCGCTTTTTGTCACCGACTCTGACACCATTCCATCCTCGCAAGAATCGACGCAAACCACCGTTTTCGACATGCCG
CCTCGTCAAATGCAAAATATCCTCAACTCACCGGAGCCACCATCACCTGATTCAAATACAAACAAAAGGCGCCGC
CTTGATTCCAACACGGGCAACCCTCAAAATTCAACCGCACCGGCTCTGGTTCTGCCTCAGCGACCGTCCTTTACC
AATGACCTCTTTTCCGAGGACGCTCTTGGTCATGATACTCAGGCCACGCCAACCATCGATCTCACAGTGTCGGCT
GAAGCCATAGAACAGCAATTTAGCAAGCCTGAGCCGGACAAGCGAATCAAGCTGGCTTCCTTTCAGTGCGTCATT
TGCATGGACGACGTCACGGCACTTACCGTCACACACTGTGGTATCTTGTCCCCATCCTCCCACTATCCGACGTGG
TCACAATAGAGCAATCCTCTAACCAAGTGAGCCAGGTCATCTCTTTTGCCAGCAATGCCTTCACTCGTCGCTCCA
CGTCGAGGCGAATCGCGGCAACTGCCCCATGTGCCGCACAAAAATTGATACCAAGCCCCGTGTTTCTTACACCTC
CAAGACAAAGGGATACTGGCCTCTGGAACTCAAGCTCATGACAGTGACAAAGAAGGGCAAGCGCAAGGCCAATGT
GATAAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail