Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3173
Gene name
LocationContig_234:10855..12638
Strand+
Gene length (bp)1783
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07958 DUF1688 Protein of unknown function (DUF1688) 5.0E-180 75 509

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A5H0J3|URC4_LACKL Uracil catabolism protein 4 OS=Lachancea kluyveri GN=URC4 PE=3 SV=1 71 509 6.0E-114
sp|Q9US42|URG3_SCHPO Protein urg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urg3 PE=2 SV=1 69 509 2.0E-106

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3303
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3173 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1730
Ophiocordyceps camponoti-floridani Ophcf2|03071
Ophiocordyceps camponoti-rufipedis Ophun1|4209
Ophiocordyceps kimflemingae Ophio5|2422
Ophiocordyceps subramaniannii Hirsu2|6086

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3173
MGLFSRKDKSTKGASSIATSQSTTSFNSGTSRAVGNRISAGSMTSATPLSPMSPVKLPKIDLPRPPDPSLDPAGY
LRSLGAVRERCHIVMQKTLKNELNHFDVDLNKFPDVVSFVSGLIKRDHEAPLTNIPGHGRYQHFCVGGRDRIAQM
LSTWPANVDKAERCRRLVDLFLVSVLLDAGAGNQWKYKSSENDRLYRRSEGLAIASLDMFKAGLFSGDASNKLQV
DKVGLKALTVEKLAAGLQSRPGNELAGLEGRTALLIRLADALDENKEFFGADGRPGNMTDHLLSHPSAQASSMLI
VPLPVLWNVLMSGLSSIWPPSRTTLHGVSLGDAWPCKAMPQDGVGSWKSILPFHKLTQWLTYSLMQPMQSLLNMH
FAGTELLTGLPEYRNGGLFVDMGVLTLKPDDRERGLQNYNDYCRRMGVEKCDQAPMFEPADDVVVEWRGVTVGLL
DKLCTDVNEALKDELHNEKLTLPQVLEAGSWKGGREIAEIHRPMTKEPPILIESDGTVF*
Coding >OphauG2|3173
ATGGGTCTATTTTCCCGCAAAGACAAGTCGACCAAGGGCGCTTCCTCGATTGCCACATCGCAGTCAACCACCAGC
TTCAACTCGGGCACCTCACGCGCTGTTGGCAACCGCATATCTGCAGGCAGCATGACGTCTGCAACTCCTCTGTCG
CCCATGTCGCCCGTCAAGCTTCCCAAGATTGACTTGCCCCGTCCCCCGGACCCGAGCCTTGATCCGGCCGGCTAT
CTCCGCAGTCTGGGAGCCGTCCGTGAACGCTGTCATATTGTCATGCAAAAAACGCTCAAAAATGAGCTGAATCAT
TTCGACGTGGACCTCAACAAGTTTCCCGATGTTGTCAGCTTCGTATCTGGCCTAATCAAGCGAGACCATGAGGCA
CCCTTAACCAACATTCCGGGCCACGGCCGATACCAGCATTTTTGTGTGGGCGGCCGTGACCGAATAGCTCAGATG
CTCTCTACGTGGCCTGCCAACGTGGACAAGGCAGAGAGGTGTCGTCGACTAGTTGATCTTTTCCTCGTTAGCGTC
CTGTTGGATGCAGGCGCTGGCAACCAGTGGAAGTACAAGAGCTCCGAAAACGATCGTCTTTATAGGCGCTCCGAG
GGCTTGGCCATTGCCAGTTTGGACATGTTCAAGGCTGGCCTCTTTTCCGGAGATGCCTCCAACAAGCTCCAGGTC
GACAAGGTTGGATTGAAGGCCTTGACGGTGGAAAAGCTGGCTGCAGGACTGCAATCCCGCCCGGGCAATGAGCTG
GCTGGCCTCGAGGGACGCACAGCGCTTCTCATTAGACTGGCCGATGCACTCGACGAGAACAAGGAGTTTTTTGGC
GCAGATGGCCGTCCTGGAAACATGACTGACCATTTGCTCTCGCATCCGTCGGCTCAGGCATCTTCCATGCTCATC
GTGCCCCTCCCGGTCCTGTGGAATGTCCTCATGAGTGGCTTGTCAAGCATTTGGCCTCCGTCGCGGACGACGCTT
CACGGTGTTTCTCTGGGAGATGCCTGGCCGTGTAAAGCCATGCCACAGGATGGCGTGGGATCATGGAAGTCCATT
TTGCCTTTCCACAAATTAACTCAGTGGCTCACGTACTCGCTGATGCAGCCCATGCAGTCGCTGCTCAATATGCAT
TTTGCTGGTACCGAGCTGCTCACTGGCCTGCCTGAGTACCGTAACGGCGGCCTTTTTGTCGACATGGGCGTCCTA
ACTCTCAAGCCCGACGACAGGGAGCGCGGCCTGCAAAACTACAATGACTATTGTCGACGCATGGGTGTGGAAAAG
TGTGACCAGGCACCCATGTTTGAGCCGGCAGACGATGTCGTGGTTGAATGGAGAGGAGTTACGGTCGGCTTGCTC
GACAAGCTATGCACCGACGTCAATGAAGCGCTAAAAGATGAACTGCATAATGAGAAGCTCACGCTGCCCCAAGTC
CTTGAGGCTGGAAGCTGGAAGGGAGGCCGCGAGATTGCTGAAATTCATCGTCCCATGACCAAGGAGCCTCCGATT
CTTATCGAGAGTGACGGCACTGTCTTTTAG
Transcript >OphauG2|3173
ATGGGTCTATTTTCCCGCAAAGACAAGTCGACCAAGGGCGCTTCCTCGATTGCCACATCGCAGTCAACCACCAGC
TTCAACTCGGGCACCTCACGCGCTGTTGGCAACCGCATATCTGCAGGCAGCATGACGTCTGCAACTCCTCTGTCG
CCCATGTCGCCCGTCAAGCTTCCCAAGATTGACTTGCCCCGTCCCCCGGACCCGAGCCTTGATCCGGCCGGCTAT
CTCCGCAGTCTGGGAGCCGTCCGTGAACGCTGTCATATTGTCATGCAAAAAACGCTCAAAAATGAGCTGAATCAT
TTCGACGTGGACCTCAACAAGTTTCCCGATGTTGTCAGCTTCGTATCTGGCCTAATCAAGCGAGACCATGAGGCA
CCCTTAACCAACATTCCGGGCCACGGCCGATACCAGCATTTTTGTGTGGGCGGCCGTGACCGAATAGCTCAGATG
CTCTCTACGTGGCCTGCCAACGTGGACAAGGCAGAGAGGTGTCGTCGACTAGTTGATCTTTTCCTCGTTAGCGTC
CTGTTGGATGCAGGCGCTGGCAACCAGTGGAAGTACAAGAGCTCCGAAAACGATCGTCTTTATAGGCGCTCCGAG
GGCTTGGCCATTGCCAGTTTGGACATGTTCAAGGCTGGCCTCTTTTCCGGAGATGCCTCCAACAAGCTCCAGGTC
GACAAGGTTGGATTGAAGGCCTTGACGGTGGAAAAGCTGGCTGCAGGACTGCAATCCCGCCCGGGCAATGAGCTG
GCTGGCCTCGAGGGACGCACAGCGCTTCTCATTAGACTGGCCGATGCACTCGACGAGAACAAGGAGTTTTTTGGC
GCAGATGGCCGTCCTGGAAACATGACTGACCATTTGCTCTCGCATCCGTCGGCTCAGGCATCTTCCATGCTCATC
GTGCCCCTCCCGGTCCTGTGGAATGTCCTCATGAGTGGCTTGTCAAGCATTTGGCCTCCGTCGCGGACGACGCTT
CACGGTGTTTCTCTGGGAGATGCCTGGCCGTGTAAAGCCATGCCACAGGATGGCGTGGGATCATGGAAGTCCATT
TTGCCTTTCCACAAATTAACTCAGTGGCTCACGTACTCGCTGATGCAGCCCATGCAGTCGCTGCTCAATATGCAT
TTTGCTGGTACCGAGCTGCTCACTGGCCTGCCTGAGTACCGTAACGGCGGCCTTTTTGTCGACATGGGCGTCCTA
ACTCTCAAGCCCGACGACAGGGAGCGCGGCCTGCAAAACTACAATGACTATTGTCGACGCATGGGTGTGGAAAAG
TGTGACCAGGCACCCATGTTTGAGCCGGCAGACGATGTCGTGGTTGAATGGAGAGGAGTTACGGTCGGCTTGCTC
GACAAGCTATGCACCGACGTCAATGAAGCGCTAAAAGATGAACTGCATAATGAGAAGCTCACGCTGCCCCAAGTC
CTTGAGGCTGGAAGCTGGAAGGGAGGCCGCGAGATTGCTGAAATTCATCGTCCCATGACCAAGGAGCCTCCGATT
CTTATCGAGAGTGACGGCACTGTCTTTTAG
Gene >OphauG2|3173
ATGGGTCTATTTTCCCGCAAAGACAAGTCGACCAAGGGCGCTTCCTCGATTGCCACATCGCAGTCAACCACCAGC
TTCAACTCGGGCACCTCACGCGCTGTTGGCAACCGCATATCTGCAGGCAGCATGACGTCTGCAACTCCTCTGTCG
CCCATGTCGCCCGTCAAGCTTCCCAAGATTGACTTGCCCCGTCCCCCGGACCCGAGCCTTGATCCGGCCGGCTAT
CTCCGCAGTCTGGGAGCCGTCCGTGAACGCTGTCATATTGTCATGCAAAAAACGCTCAAAAATGAGCTGAATCAT
TTCGACGTGGACCTCAACAAGTTTCCCGATGTTGTCAGCTTCGTATCTGGCCTAATCAAGGTACCGCTGCTTGTC
CTTCCCTAATTGCATAGCAGCTGACAGCTCTGAATAGCGAGACCATGAGGCACCCTTAACCAACATTCCGGGCCA
CGGCCGATACCAGCATTTTTGTGTGGGCGGCCGTGACCGAATAGCTCAGATGCTCTCTACGTGGCCTGCCAACGT
GGACAAGGCAGAGAGGTGTCGTCGACTAGTTGATCTTTTCCTCGTTAGCGTCCTGTTGGATGCAGGCGCTGGCAA
CCAGTGGAAGTACAAGAGCTCCGAAAACGATCGTCTTTATAGGCGCTCCGAGGGCTTGGCCATTGCCAGTTTGGA
CATGTTCAAGGCTGTATGTGGACCAACAAGTGTGCAGCCCTATTTGCTTTTTAGCCGACCAATTAACATGTCGTC
TGACAGGGCCTCTTTTCCGGAGATGCCTCCAACAAGCTCCAGGTCGACAAGGTTGGATTGAAGGCCTTGACGGTG
GAAAAGCTGGCTGCAGGACTGCAATCCCGCCCGGGCAATGAGCTGGCTGGCCTCGAGGGACGCACAGCGCTTCTC
ATTAGACTGGCCGATGCACTCGACGAGAACAAGGAGTTTTTTGGCGCAGATGGCCGTCCTGGAAACATGACTGGT
GTGACTTGCCCCTCGGTCTGAATCATGACAATTTTCAATTTGCTAAATAACATGTCCAGACCATTTGCTCTCGCA
TCCGTCGGCTCAGGCATCTTCCATGCTCATCGTGCCCCTCCCGGTCCTGTGGAATGTCCTCATGAGTGGCTTGTC
AAGCATTTGGCCTCCGTCGCGGACGACGCTTCACGGTGTTTCTCTGGGAGATGCCTGGCCGTGTAAAGCCATGCC
ACAGGATGGCGTGGGATCATGGAAGTCCATTTTGCCTTTCCACAAATTAACTCAGTGGCTCACGTACTCGCTGAT
GCAGCCCATGCAGTCGCTGCTCAATATGCATTTTGCTGGTACCGAGCTGCTCACTGGCCTGCCTGAGTACCGTAA
CGGCGGCCTTTTTGTCGACATGGGCGTCCTAACTCTCAAGCCCGACGACAGGGAGCGCGGCCTGCAAAACTACAA
TGACTATTGTCGACGCATGGGTGTGGAAAAGTGTGACCAGGCACCCATGTTTGAGCCGGCAGACGATGTCGTGGT
TGAATGGAGAGGAGTTACGGTCGGCTTGCTCGACAAGCTATGCACCGACGTCAATGAAGCGCTAAAAGATGAACT
GCATAATGAGAAGCTCACGCTGCCCCAAGTCCTTGAGGCTGGAAGCTGGAAGGTGAGCTGCTTGCGCCACTACGC
TTGGCTTGATCGTTGGGAGAGAGACATTGGGCTGACTTGAAGACAATAGGGAGGCCGCGAGATTGCTGAAATTCA
TCGTCCCATGACCAAGGAGCCTCCGATTCTTATCGAGAGTGACGGCACTGTCTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail