Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3160
Gene name
LocationContig_232:20327..22431
Strand+
Gene length (bp)2104
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00264 Tyrosinase Common central domain of tyrosinase 2.9E-43 76 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 31 398 2.0E-46
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 38 422 1.0E-45
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 59 460 2.0E-42
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 24 401 2.0E-42
sp|O42713|PPO2_AGABI Polyphenol oxidase 2 OS=Agaricus bisporus GN=PPO2 PE=2 SV=1 59 398 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 31 398 2.0E-46
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 38 422 1.0E-45
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 59 460 2.0E-42
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 24 401 2.0E-42
sp|O42713|PPO2_AGABI Polyphenol oxidase 2 OS=Agaricus bisporus GN=PPO2 PE=2 SV=1 59 398 4.0E-39
sp|C7FF04|PPO3_AGABI Polyphenol oxidase 3 OS=Agaricus bisporus GN=PPO3 PE=1 SV=1 30 398 3.0E-34
sp|C7FF05|PPO4_AGABI Polyphenol oxidase 4 OS=Agaricus bisporus GN=PPO4 PE=2 SV=1 59 373 3.0E-33
sp|Q8J130|TYRO_ASPFU Tyrosinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tyr1 PE=3 SV=2 24 398 5.0E-29
sp|Q00234|TYRO_ASPOR Tyrosinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=melO PE=1 SV=1 30 384 2.0E-15
sp|O61363|HCYG_ENTDO Hemocyanin G-type, units Oda to Odg OS=Enteroctopus dofleini GN=ODHCY PE=1 SV=1 109 390 9.0E-11
sp|P12659|HCYA_ENTDO Hemocyanin A-type, units Ode to Odg (Fragment) OS=Enteroctopus dofleini PE=2 SV=2 39 396 9.0E-11
sp|P80960|HCY2A_RAPVE Hemocyanin type 2 unit a OS=Rapana venosa PE=1 SV=2 42 414 1.0E-10
sp|O61363|HCYG_ENTDO Hemocyanin G-type, units Oda to Odg OS=Enteroctopus dofleini GN=ODHCY PE=1 SV=1 109 396 1.0E-09
sp|P12031|HCYB_HELPO Hemocyanin, beta-C chain unit D (Fragment) OS=Helix pomatia PE=1 SV=2 109 392 2.0E-09
sp|P56824|HCYC_SEPOF Hemocyanin, units C and D (Fragments) OS=Sepia officinalis PE=1 SV=1 36 195 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3160
MLFSTVSSAVMLCLASVASAQNSSSSIPYPIVGFQVSGDIPLRRNINELQADGGPHWDLFIQSLAVMRDADPDDP
LSFFQVAGIHGLPHVEWNNTGARAENTDRWGGYCPHGEPLFLTWHRIYVLLNEQILVSNARQIASTYPESSRDEY
LQAAETLRYPYWDWADNSDLPEATASRNLTVNTPEGQQSIANPLSGFNFPEKALNGGFGAFDASPAGSRTQVMRC
ASGSFPETANSQMKNEDWKQLVYDAFLYSRNFADFASSRGGGLSMEEIHNTVHAEATCFGHFANQNFAAFDPIFT
MHHVQVDRLFSYWETLHPEEGEFLKSYEGGSRWGHPEGNQVSPRSPLHPFFRESGRPHTPRSSSPISRFGYTYEG
LNFGGQSAFEMQKEIRRIMNERYSNNRNALQKRAGNSTDDEQQVFLARLKYNVEEIDRPAVIRVFVNDDECGKII
VPEEPHMGMVGGAVSLKKAISAMADKQMPIENITSAVRVEISRNSGEKIPLTKIPSMKLELDHMMEVPNQSPEDF
PELRDRESIPAEVVEHDIDIRR*
Coding >OphauG2|3160
ATGCTCTTTTCTACGGTTTCTTCAGCTGTGATGCTGTGCTTGGCCTCTGTGGCATCAGCTCAGAATAGTTCGTCG
TCTATCCCGTATCCCATTGTCGGCTTCCAAGTCAGTGGAGATATTCCATTGCGTCGCAATATCAACGAGCTCCAG
GCAGATGGTGGACCTCATTGGGATCTCTTTATACAATCTCTTGCCGTGATGAGAGATGCAGATCCTGATGATCCT
CTTTCATTTTTCCAGGTTGCAGGGATTCATGGCCTTCCTCACGTCGAGTGGAATAATACAGGCGCTAGGGCTGAG
AATACTGATCGATGGGGAGGCTACTGTCCTCATGGGGAGCCGCTGTTTTTGACATGGCATCGCATCTATGTTTTG
CTCAATGAGCAAATCTTGGTGAGCAACGCCCGACAAATTGCCAGCACATATCCAGAATCGAGCCGCGACGAGTAC
CTGCAAGCCGCAGAGACGCTCAGGTACCCGTACTGGGACTGGGCAGACAACAGCGATCTTCCCGAGGCAACTGCT
TCCCGCAACCTTACTGTCAACACGCCCGAAGGACAACAATCCATTGCAAATCCCTTGTCAGGATTCAACTTTCCC
GAAAAGGCACTCAACGGCGGATTTGGAGCCTTTGATGCCAGTCCCGCCGGGAGCCGTACTCAGGTGATGCGCTGT
GCCTCGGGCTCATTCCCTGAAACAGCAAACTCGCAGATGAAGAATGAAGACTGGAAGCAGCTGGTTTATGATGCC
TTTCTTTACTCGCGAAACTTTGCCGACTTTGCCTCGTCGCGAGGAGGCGGTCTCAGCATGGAGGAGATTCACAAT
ACAGTCCATGCTGAAGCAACCTGCTTCGGACACTTTGCCAACCAAAACTTTGCCGCTTTTGATCCAATCTTCACC
ATGCATCATGTCCAGGTGGACCGCTTGTTCAGCTACTGGGAAACCCTCCACCCCGAGGAAGGTGAGTTTCTCAAA
AGCTACGAGGGCGGATCTCGATGGGGCCACCCCGAAGGCAACCAAGTCAGCCCTCGATCTCCGCTGCACCCATTT
TTCCGTGAGAGCGGAAGACCTCACACGCCGAGAAGCTCGTCGCCAATCAGCCGCTTTGGCTATACGTATGAAGGC
CTCAACTTTGGGGGCCAGTCCGCGTTTGAGATGCAAAAAGAAATTCGCCGAATCATGAATGAGCGATACTCCAAC
AACCGCAATGCGCTTCAGAAGCGTGCCGGCAACAGCACCGATGATGAACAGCAAGTGTTTTTGGCCCGTCTCAAG
TACAATGTCGAAGAAATCGACAGACCGGCTGTAATCAGAGTCTTTGTCAACGACGATGAGTGTGGCAAGATTATT
GTGCCCGAGGAGCCTCATATGGGCATGGTGGGCGGAGCAGTGTCCTTGAAAAAGGCCATCTCTGCCATGGCTGAC
AAGCAAATGCCCATTGAAAACATTACCAGCGCAGTTCGCGTGGAAATTTCTCGTAATTCCGGAGAGAAAATCCCA
CTTACAAAGATACCCAGCATGAAGCTTGAATTGGACCACATGATGGAGGTTCCAAACCAGTCTCCCGAAGACTTT
CCAGAGCTTCGCGATCGCGAATCTATTCCTGCAGAAGTCGTGGAGCACGATATCGATATCCGTCGATAG
Transcript >OphauG2|3160
ATGCTCTTTTCTACGGTTTCTTCAGCTGTGATGCTGTGCTTGGCCTCTGTGGCATCAGCTCAGAATAGTTCGTCG
TCTATCCCGTATCCCATTGTCGGCTTCCAAGTCAGTGGAGATATTCCATTGCGTCGCAATATCAACGAGCTCCAG
GCAGATGGTGGACCTCATTGGGATCTCTTTATACAATCTCTTGCCGTGATGAGAGATGCAGATCCTGATGATCCT
CTTTCATTTTTCCAGGTTGCAGGGATTCATGGCCTTCCTCACGTCGAGTGGAATAATACAGGCGCTAGGGCTGAG
AATACTGATCGATGGGGAGGCTACTGTCCTCATGGGGAGCCGCTGTTTTTGACATGGCATCGCATCTATGTTTTG
CTCAATGAGCAAATCTTGGTGAGCAACGCCCGACAAATTGCCAGCACATATCCAGAATCGAGCCGCGACGAGTAC
CTGCAAGCCGCAGAGACGCTCAGGTACCCGTACTGGGACTGGGCAGACAACAGCGATCTTCCCGAGGCAACTGCT
TCCCGCAACCTTACTGTCAACACGCCCGAAGGACAACAATCCATTGCAAATCCCTTGTCAGGATTCAACTTTCCC
GAAAAGGCACTCAACGGCGGATTTGGAGCCTTTGATGCCAGTCCCGCCGGGAGCCGTACTCAGGTGATGCGCTGT
GCCTCGGGCTCATTCCCTGAAACAGCAAACTCGCAGATGAAGAATGAAGACTGGAAGCAGCTGGTTTATGATGCC
TTTCTTTACTCGCGAAACTTTGCCGACTTTGCCTCGTCGCGAGGAGGCGGTCTCAGCATGGAGGAGATTCACAAT
ACAGTCCATGCTGAAGCAACCTGCTTCGGACACTTTGCCAACCAAAACTTTGCCGCTTTTGATCCAATCTTCACC
ATGCATCATGTCCAGGTGGACCGCTTGTTCAGCTACTGGGAAACCCTCCACCCCGAGGAAGGTGAGTTTCTCAAA
AGCTACGAGGGCGGATCTCGATGGGGCCACCCCGAAGGCAACCAAGTCAGCCCTCGATCTCCGCTGCACCCATTT
TTCCGTGAGAGCGGAAGACCTCACACGCCGAGAAGCTCGTCGCCAATCAGCCGCTTTGGCTATACGTATGAAGGC
CTCAACTTTGGGGGCCAGTCCGCGTTTGAGATGCAAAAAGAAATTCGCCGAATCATGAATGAGCGATACTCCAAC
AACCGCAATGCGCTTCAGAAGCGTGCCGGCAACAGCACCGATGATGAACAGCAAGTGTTTTTGGCCCGTCTCAAG
TACAATGTCGAAGAAATCGACAGACCGGCTGTAATCAGAGTCTTTGTCAACGACGATGAGTGTGGCAAGATTATT
GTGCCCGAGGAGCCTCATATGGGCATGGTGGGCGGAGCAGTGTCCTTGAAAAAGGCCATCTCTGCCATGGCTGAC
AAGCAAATGCCCATTGAAAACATTACCAGCGCAGTTCGCGTGGAAATTTCTCGTAATTCCGGAGAGAAAATCCCA
CTTACAAAGATACCCAGCATGAAGCTTGAATTGGACCACATGATGGAGGTTCCAAACCAGTCTCCCGAAGACTTT
CCAGAGCTTCGCGATCGCGAATCTATTCCTGCAGAAGTCGTGGAGCACGATATCGATATCCGTCGATAG
Gene >OphauG2|3160
ATGCTCTTTTCTACGGTTTCTTCAGCTGTGATGCTGTGCTTGGCCTCTGTGGCATCAGCTCAGAATAGTTCGTCG
TCTATCCCGTATCCCATTGTCGGCTTCCAAGTCAGTGGAGATATTCCATTGCGTCGCAATATCAACGAGCTCCAG
GCAGATGGTGGACCTCATTGGTAAGTGATTTGCCATCATCTGGCGACATGTGATAGGCTAACAACTTTAGGGATC
TCTTTATACAATCTCTTGCCGTGATGAGAGATGCAGATCCTGATGATCCTCTTTCATTTTTCCAGGTTGCAGGTG
CGCAAAAATCCTACATGGCAGATGCTATACGGGGAGTCTGTGCTTTCAACATGACATTCCTAACTGTTGATGATA
GGGATTCATGGCCTTCCTCACGTCGAGTGGAATAATACAGGCGCTAGGGCTGAGAATACTGATCGATGGGGAGGC
TACTGTCCTCATGGGGTACGTCTTTTGAATTGGCCCCGCAATCAAGGACGAAAGTCTAACTCTTCTTGATAGGAG
CCGCTGTTTTTGACATGGCATCGCATCTATGTTTTGCTCAATGAGGTAAGGAACATTTTGGGACAGAAAAAAAAA
GTCAGGCGTCTAATCAAGCAATAGCAAATCTTGGTGAGCAACGCCCGACAAATTGCCAGCACATATCCAGAATCG
AGCCGCGACGAGTACCTGCAAGCCGCAGAGACGCTCAGGTACCCGTACTGGGACTGGGCAGACAACAGCGATCTT
CCCGAGGCAACTGCTTCCCGCAACCTTACTGTCAACACGCCCGAAGGACAACAATCCATTGCAAATCCCTTGTCA
GGATTCAACTTTCCCGAAAAGGCACTCAACGGCGGATTTGGAGCCTTTGATGCCAGTCCCGCCGGGAGCCGTACT
CAGGTGATGCGCTGTGCCTCGGGCTCATTCCCTGAAACAGCAAACTCGCAGATGAAGAATGAAGACTGGAAGCAG
CTGGTTGTAAGTGACTGCACAGGAAATCTCCTTGTCTCAACGTGATGCTGACATTTGACAAGTATGATGCCTTTC
TTTACTCGCGAAACTTTGCCGACTTTGCCTCGTCGCGAGGAGGCGGTCTCAGCATGGAGGAGATTCACAATACAG
TCCATGCTGAAGCAACCTGCTTCGGACACTTTGCCAACCAAAACTTTGCCGCTTTTGATCCAATCTTGTAAGTCG
GACAGCAGCCCGGCCAAGACTCAAACTAACATGGCATGTCTCTTCAGCACCATGCATCATGTCCAGGTGGACCGC
TTGTTCAGCTACTGGGAAACCCTCCACCCCGAGGAAGGTGAGTTTCTCAAAAGCTACGAGGGCGGATCTCGATGG
GGCCACCCCGAAGGCAACCAAGTCAGCCCTCGATCTCCGCTGCACCCATTTTTCCGTGAGAGCGGAAGACCTCAC
ACGCCGAGAAGCTCGTCGCCAATCAGCCGCTTTGGCTATACGTATGAAGGCCTCAACTTTGGGGGCCAGTCCGCG
TTTGAGATGCAAAAAGAAATTCGCCGAATCATGAATGAGCGATACTCCAACAACCGCAATGCGCTTCAGAAGCGT
GCCGGCAACAGCACCGATGATGAACAGCAAGTGTTTTTGGCCCGTCTCAAGTACAATGTCGAAGAAATCGACAGA
CCGGCTGTAATCAGAGTCTTTGTCAACGACGATGAGTGTGGCAAGATTATTGTGCCCGAGGAGCCTCATATGGGC
ATGGTGGGCGGAGCAGTGTCCTTGAAAAAGGCCATCTCTGCCATGGCTGACAAGCAAATGCCCATTGAAAACATT
ACCAGCGCAGTTCGCGTGGAAATTTCTCGTGTAAGTGTTTTCTTTTTTTTCCTTTTTTTCCTTTTTTTCCTTTTT
TTCTCTTTTTTCCCTTTTTTTGGCCAAACAAAAGGTGCCATCATCAAGCTGACGCGTGGCATAGAATTCCGGAGA
GAAAATCCCACTTACAAAGATACCCAGCATGAAGCTTGAATTGGACCACATGATGGAGGTTCCAAACCAGTCTCC
CGAAGACTTTCCAGAGCTTCGCGATCGCGAATCTATTCCTGCAGAAGTCGTGGAGCACGATATCGATATCCGTCG
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail