Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3150
Gene name
LocationContig_231:10238..11758
Strand+
Gene length (bp)1520
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00928 Adap_comp_sub Adaptor complexes medium subunit family 7.0E-90 156 442
PF01217 Clat_adaptor_s Clathrin adaptor complex small chain 2.0E-07 3 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BXS5|AP1M1_HUMAN AP-1 complex subunit mu-1 OS=Homo sapiens GN=AP1M1 PE=1 SV=3 2 442 0.0E+00
sp|Q9HFE5|AP1M1_SCHPO AP-1 complex subunit mu-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apm1 PE=1 SV=1 1 437 0.0E+00
sp|Q9SAC9|AP1M1_ARATH AP-1 complex subunit mu-1 OS=Arabidopsis thaliana GN=AP1M1 PE=3 SV=1 2 443 0.0E+00
sp|Q00776|AP1M1_YEAST AP-1 complex subunit mu-1-I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APM1 PE=1 SV=2 1 438 0.0E+00
sp|O22715|AP1M2_ARATH AP-1 complex subunit mu-2 OS=Arabidopsis thaliana GN=AP1M2 PE=1 SV=1 2 443 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BXS5|AP1M1_HUMAN AP-1 complex subunit mu-1 OS=Homo sapiens GN=AP1M1 PE=1 SV=3 2 442 0.0E+00
sp|Q9HFE5|AP1M1_SCHPO AP-1 complex subunit mu-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apm1 PE=1 SV=1 1 437 0.0E+00
sp|Q9SAC9|AP1M1_ARATH AP-1 complex subunit mu-1 OS=Arabidopsis thaliana GN=AP1M1 PE=3 SV=1 2 443 0.0E+00
sp|Q00776|AP1M1_YEAST AP-1 complex subunit mu-1-I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APM1 PE=1 SV=2 1 438 0.0E+00
sp|O22715|AP1M2_ARATH AP-1 complex subunit mu-2 OS=Arabidopsis thaliana GN=AP1M2 PE=1 SV=1 2 443 0.0E+00
sp|Q9WVP1|AP1M2_MOUSE AP-1 complex subunit mu-2 OS=Mus musculus GN=Ap1m2 PE=1 SV=3 2 442 0.0E+00
sp|Q3SYW1|AP1M2_BOVIN AP-1 complex subunit mu-2 OS=Bos taurus GN=AP1M2 PE=1 SV=3 2 442 0.0E+00
sp|Q54HS9|AP1M_DICDI AP-1 complex subunit mu OS=Dictyostelium discoideum GN=apm1 PE=1 SV=1 2 442 0.0E+00
sp|P35602|AP1M_CAEEL AP-1 complex subunit mu-1-I OS=Caenorhabditis elegans GN=unc-101 PE=2 SV=2 2 443 0.0E+00
sp|P35585|AP1M1_MOUSE AP-1 complex subunit mu-1 OS=Mus musculus GN=Ap1m1 PE=1 SV=3 2 442 0.0E+00
sp|Q32Q06|AP1M1_RAT AP-1 complex subunit mu-1 OS=Rattus norvegicus GN=Ap1m1 PE=1 SV=3 2 442 0.0E+00
sp|Q2KJ81|AP1M1_BOVIN AP-1 complex subunit mu-1 OS=Bos taurus GN=AP1M1 PE=1 SV=3 2 442 0.0E+00
sp|Q9Y6Q5|AP1M2_HUMAN AP-1 complex subunit mu-2 OS=Homo sapiens GN=AP1M2 PE=1 SV=4 2 442 0.0E+00
sp|O23140|AP2M_ARATH AP-2 complex subunit mu OS=Arabidopsis thaliana GN=AP2M PE=1 SV=1 2 442 1.0E-114
sp|P54672|AP2M_DICDI AP-2 complex subunit mu OS=Dictyostelium discoideum GN=apm2 PE=2 SV=2 1 443 5.0E-113
sp|Q5ZMP6|AP2M1_CHICK AP-2 complex subunit mu OS=Gallus gallus GN=AP2M1 PE=2 SV=1 1 437 6.0E-107
sp|Q6P856|AP2M1_XENTR AP-2 complex subunit mu OS=Xenopus tropicalis GN=ap2m1 PE=2 SV=1 1 437 2.0E-106
sp|Q801Q8|AP2M1_XENLA AP-2 complex subunit mu OS=Xenopus laevis GN=ap2m1 PE=2 SV=1 1 437 7.0E-106
sp|P84092|AP2M1_RAT AP-2 complex subunit mu OS=Rattus norvegicus GN=Ap2m1 PE=1 SV=1 1 437 1.0E-105
sp|Q3ZC13|AP2M1_BOVIN AP-2 complex subunit mu OS=Bos taurus GN=AP2M1 PE=2 SV=1 1 437 1.0E-105
sp|Q96CW1|AP2M1_HUMAN AP-2 complex subunit mu OS=Homo sapiens GN=AP2M1 PE=1 SV=2 1 437 1.0E-105
sp|Q4R706|AP2M1_MACFA AP-2 complex subunit mu OS=Macaca fascicularis GN=AP2M1 PE=2 SV=1 1 437 1.0E-105
sp|P84091|AP2M1_MOUSE AP-2 complex subunit mu OS=Mus musculus GN=Ap2m1 PE=1 SV=1 1 437 1.0E-105
sp|Q7ZW98|AP2MB_DANRE AP-2 complex subunit mu-B OS=Danio rerio GN=ap2m1b PE=2 SV=1 1 437 8.0E-104
sp|Q6NWK2|AP2MA_DANRE AP-2 complex subunit mu-A OS=Danio rerio GN=ap2m1a PE=2 SV=1 1 437 4.0E-103
sp|Q5NVF7|AP2M1_PONAB AP-2 complex subunit mu OS=Pongo abelii GN=AP2M1 PE=2 SV=1 1 437 4.0E-103
sp|P35603|AP2M_CAEEL AP-2 complex subunit mu OS=Caenorhabditis elegans GN=dpy-23 PE=2 SV=2 1 437 4.0E-101
sp|Q09718|AP2M_SCHPO AP-2 complex subunit mu OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apm4 PE=1 SV=1 1 443 2.0E-93
sp|Q9SB50|AP4M_ARATH AP-4 complex subunit mu OS=Arabidopsis thaliana GN=AP4M PE=2 SV=1 1 443 2.0E-83
sp|Q9GPF1|AP3M_DICDI AP-3 complex subunit mu OS=Dictyostelium discoideum GN=apm3 PE=2 SV=1 1 442 3.0E-54
sp|O00189|AP4M1_HUMAN AP-4 complex subunit mu-1 OS=Homo sapiens GN=AP4M1 PE=1 SV=2 1 443 5.0E-52
sp|Q5ZMP7|AP3M1_CHICK AP-3 complex subunit mu-1 OS=Gallus gallus GN=AP3M1 PE=2 SV=1 1 442 9.0E-52
sp|Q5R478|AP3M1_PONAB AP-3 complex subunit mu-1 OS=Pongo abelii GN=AP3M1 PE=2 SV=1 1 442 9.0E-52
sp|Q9Y2T2|AP3M1_HUMAN AP-3 complex subunit mu-1 OS=Homo sapiens GN=AP3M1 PE=1 SV=1 1 442 9.0E-52
sp|Q24K11|AP3M1_BOVIN AP-3 complex subunit mu-1 OS=Bos taurus GN=AP3M1 PE=2 SV=1 1 442 1.0E-51
sp|Q9JKC8|AP3M1_MOUSE AP-3 complex subunit mu-1 OS=Mus musculus GN=Ap3m1 PE=1 SV=1 1 442 1.0E-51
sp|P53676|AP3M1_RAT AP-3 complex subunit mu-1 OS=Rattus norvegicus GN=Ap3m1 PE=1 SV=1 1 442 1.0E-50
sp|Q29RY8|AP4M1_BOVIN AP-4 complex subunit mu-1 OS=Bos taurus GN=AP4M1 PE=2 SV=1 1 443 4.0E-50
sp|Q2PWT8|AP4M1_RAT AP-4 complex subunit mu-1 OS=Rattus norvegicus GN=Ap4m1 PE=1 SV=1 1 443 5.0E-50
sp|Q9JKC7|AP4M1_MOUSE AP-4 complex subunit mu-1 OS=Mus musculus GN=Ap4m1 PE=2 SV=1 1 443 4.0E-49
sp|Q99186|AP2M_YEAST AP-2 complex subunit mu OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APM4 PE=1 SV=1 1 442 7.0E-49
sp|P53678|AP3M2_RAT AP-3 complex subunit mu-2 OS=Rattus norvegicus GN=Ap3m2 PE=2 SV=1 1 442 3.0E-44
sp|Q8R2R9|AP3M2_MOUSE AP-3 complex subunit mu-2 OS=Mus musculus GN=Ap3m2 PE=1 SV=1 1 442 1.0E-43
sp|Q9GPF0|AP4M_DICDI AP-4 complex subunit mu OS=Dictyostelium discoideum GN=apm4 PE=2 SV=1 1 443 2.0E-43
sp|P53677|AP3M2_HUMAN AP-3 complex subunit mu-2 OS=Homo sapiens GN=AP3M2 PE=2 SV=1 1 442 3.0E-43
sp|P47795|AP1M_DIPOM AP-1 complex subunit mu OS=Diplobatis ommata PE=2 SV=1 1 442 4.0E-42
sp|F4I562|AP3M_ARATH AP-3 complex subunit mu OS=Arabidopsis thaliana GN=AP3M PE=1 SV=1 56 362 2.0E-41
sp|P38700|APM2_YEAST Adaptin medium chain homolog APM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APM2 PE=1 SV=1 156 438 2.0E-36
sp|O94669|AP3M_SCHPO AP-3 complex subunit mu OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apm3 PE=3 SV=1 4 322 2.0E-21
sp|Q750L8|AP3M_ASHGO AP-3 complex subunit mu OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APM3 PE=3 SV=2 65 270 2.0E-15
sp|Q8CDJ8|STON1_MOUSE Stonin-1 OS=Mus musculus GN=Ston1 PE=1 SV=2 86 348 1.0E-11
sp|Q8WXE9|STON2_HUMAN Stonin-2 OS=Homo sapiens GN=STON2 PE=1 SV=1 162 399 3.0E-10
sp|Q8BZ60|STON2_MOUSE Stonin-2 OS=Mus musculus GN=Ston2 PE=1 SV=1 162 399 2.0E-09
sp|P38700|APM2_YEAST Adaptin medium chain homolog APM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APM2 PE=1 SV=1 1 135 4.0E-09
sp|D4AB66|STON2_RAT Stonin-2 OS=Rattus norvegicus GN=Ston2 PE=1 SV=1 162 399 1.0E-08
sp|Q9Y6Q2|STON1_HUMAN Stonin-1 OS=Homo sapiens GN=STON1 PE=1 SV=2 165 355 6.0E-08
sp|Q09236|COPD_CAEEL Probable coatomer subunit delta OS=Caenorhabditis elegans GN=C13B9.3 PE=3 SV=1 4 171 3.0E-07
sp|P38153|AP3M_YEAST AP-3 complex subunit mu OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APM3 PE=1 SV=2 64 274 4.0E-07
sp|Q24212|STNB_DROME Protein stoned-B OS=Drosophila melanogaster GN=stnB PE=1 SV=4 159 269 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3150
MASALFFLDLKGKTLLARNYRGDIPMSAVEQFPILLSEAEEESSAVPPCFSHQGINYLYIRHNNLYLLALTKRNT
NAAEMLLFLHKVVQVFTEYFKALEEESIRDNFVIIYELLDEMMDFGYPQTTESKILQEYITQESHKLEIQARPPI
AVTNAVSWRSEGIRYRKNEVFLDVVESLNLLVGASGNVLRSEILGAIKMKCYLSGMPELRLGLNDKVMFETTGRA
TRGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQVKPLIWVECLVESHSGSRIEYMLKAKAQ
FKRRSTANNVEIIVPVPDDADSPRFRTNIGAVHYAPEQSAIVWKIKQFGGQKEFLMRAELGLPSVRGDDEVGGGM
TGGFGGSMGGVGVGKGAKRPIQVKFEIPYFTTSGIQVRYLKITEPKLQYPSLPWVRYITQSGDIAVRLPEVV*
Coding >OphauG2|3150
ATGGCGTCGGCTCTCTTCTTCCTAGACCTCAAGGGCAAGACCCTGCTTGCCCGCAACTACAGAGGCGACATCCCC
ATGTCCGCCGTTGAGCAGTTCCCAATCCTCCTCTCCGAAGCCGAAGAAGAATCGTCGGCCGTGCCGCCATGCTTC
TCCCACCAGGGCATCAACTACCTCTACATCCGCCACAACAACCTCTACCTCCTCGCCCTCACCAAGCGCAACACA
AACGCCGCAGAGATGCTCCTCTTCCTGCACAAAGTCGTACAAGTCTTCACCGAGTACTTCAAAGCCCTCGAAGAG
GAGTCCATTCGCGACAACTTTGTCATCATCTACGAGCTCCTCGACGAAATGATGGACTTTGGCTACCCGCAAACC
ACAGAGTCCAAGATTCTTCAAGAGTACATCACCCAGGAATCACACAAGCTCGAGATCCAAGCCCGCCCCCCCATT
GCCGTGACCAATGCCGTCTCGTGGCGATCAGAGGGCATTCGATACCGCAAAAACGAAGTCTTTCTCGACGTTGTT
GAGTCGCTCAACCTCTTGGTCGGCGCGTCTGGCAACGTGCTCCGCTCCGAGATTCTCGGCGCCATCAAGATGAAG
TGCTACCTCAGCGGCATGCCCGAGCTGCGCCTCGGCCTCAACGACAAGGTCATGTTTGAGACGACGGGCCGGGCC
ACGCGCGGCAAGGCCATTGAAATGGAAGACGTCAAGTTCCACCAATGCGTCCGCCTGTCGCGCTTCGAAAACGAC
CGCACCATATCCTTCATCCCCCCCGACGGCGAGTTTGAGCTCATGTCGTACCGCCTCAACACCCAGGTCAAGCCC
CTTATTTGGGTCGAGTGCCTCGTCGAGTCGCACTCTGGCTCGCGCATCGAGTACATGCTCAAGGCCAAGGCCCAG
TTCAAGCGCCGCAGCACCGCCAACAATGTCGAAATCATTGTCCCCGTCCCCGACGACGCCGACTCGCCTCGCTTC
CGCACAAACATTGGCGCCGTCCACTACGCCCCCGAACAGAGCGCCATTGTCTGGAAGATCAAGCAGTTTGGCGGC
CAAAAAGAATTCCTCATGCGCGCCGAGCTCGGCCTGCCTTCGGTCCGTGGCGACGACGAAGTAGGAGGCGGCATG
ACGGGTGGCTTTGGCGGCAGCATGGGCGGCGTCGGCGTCGGCAAGGGAGCCAAGCGCCCCATACAAGTCAAGTTT
GAGATTCCTTATTTCACCACGAGCGGCATCCAGGTGCGCTACCTCAAAATCACAGAGCCCAAGCTTCAATATCCG
TCGCTTCCGTGGGTTCGTTACATTACACAATCGGGCGACATTGCCGTGCGCCTACCAGAAGTCGTCTAA
Transcript >OphauG2|3150
ATGGCGTCGGCTCTCTTCTTCCTAGACCTCAAGGGCAAGACCCTGCTTGCCCGCAACTACAGAGGCGACATCCCC
ATGTCCGCCGTTGAGCAGTTCCCAATCCTCCTCTCCGAAGCCGAAGAAGAATCGTCGGCCGTGCCGCCATGCTTC
TCCCACCAGGGCATCAACTACCTCTACATCCGCCACAACAACCTCTACCTCCTCGCCCTCACCAAGCGCAACACA
AACGCCGCAGAGATGCTCCTCTTCCTGCACAAAGTCGTACAAGTCTTCACCGAGTACTTCAAAGCCCTCGAAGAG
GAGTCCATTCGCGACAACTTTGTCATCATCTACGAGCTCCTCGACGAAATGATGGACTTTGGCTACCCGCAAACC
ACAGAGTCCAAGATTCTTCAAGAGTACATCACCCAGGAATCACACAAGCTCGAGATCCAAGCCCGCCCCCCCATT
GCCGTGACCAATGCCGTCTCGTGGCGATCAGAGGGCATTCGATACCGCAAAAACGAAGTCTTTCTCGACGTTGTT
GAGTCGCTCAACCTCTTGGTCGGCGCGTCTGGCAACGTGCTCCGCTCCGAGATTCTCGGCGCCATCAAGATGAAG
TGCTACCTCAGCGGCATGCCCGAGCTGCGCCTCGGCCTCAACGACAAGGTCATGTTTGAGACGACGGGCCGGGCC
ACGCGCGGCAAGGCCATTGAAATGGAAGACGTCAAGTTCCACCAATGCGTCCGCCTGTCGCGCTTCGAAAACGAC
CGCACCATATCCTTCATCCCCCCCGACGGCGAGTTTGAGCTCATGTCGTACCGCCTCAACACCCAGGTCAAGCCC
CTTATTTGGGTCGAGTGCCTCGTCGAGTCGCACTCTGGCTCGCGCATCGAGTACATGCTCAAGGCCAAGGCCCAG
TTCAAGCGCCGCAGCACCGCCAACAATGTCGAAATCATTGTCCCCGTCCCCGACGACGCCGACTCGCCTCGCTTC
CGCACAAACATTGGCGCCGTCCACTACGCCCCCGAACAGAGCGCCATTGTCTGGAAGATCAAGCAGTTTGGCGGC
CAAAAAGAATTCCTCATGCGCGCCGAGCTCGGCCTGCCTTCGGTCCGTGGCGACGACGAAGTAGGAGGCGGCATG
ACGGGTGGCTTTGGCGGCAGCATGGGCGGCGTCGGCGTCGGCAAGGGAGCCAAGCGCCCCATACAAGTCAAGTTT
GAGATTCCTTATTTCACCACGAGCGGCATCCAGGTGCGCTACCTCAAAATCACAGAGCCCAAGCTTCAATATCCG
TCGCTTCCGTGGGTTCGTTACATTACACAATCGGGCGACATTGCCGTGCGCCTACCAGAAGTCGTCTAA
Gene >OphauG2|3150
ATGGCGTCGGCTCTCTTCTTCCTAGACCTCAAGGGCAAGGTATCTCTCTGTGCCTCTCTCTCTCCCCCCCTCTCT
CTCCCTCTCTCTCCCTCTCTCCCCCCCTCTCCTCCACTCATCTCTTCCTCTCACGCAATGCTGCACAGACCCTGC
TTGCCCGCAACTACAGAGGCGACATCCCCATGTCCGCCGTTGAGCAGTTCCCAATCCTCCTCTCCGAAGCCGAAG
AAGAATCGTCGGCCGTGCCGCCATGCTTCTCCCACCAGGGCATCAACTACCTCTACATCCGCCACAACAACCTCT
ACCTCCTCGCCCTCACCAAGCGCAACACAAACGCCGCAGAGATGCTCCTCTTCCTGCACAAAGTCGTACAAGTCT
TCACCGAGTACTTCAAAGCCCTCGAAGAGGAGTCCATTCGCGACAACTTTGTCATCATCTACGAGCTCCTCGACG
AAATGATGGACTTTGGCTACCCGCAAACCACAGAGTCCAAGATTCTTCAAGAGTACATCACCCAGGAATCACACA
AGCTCGAGATCCAAGCCCGCCCCCCCATTGCCGTGACCAATGCCGTCTCGTGGCGATCAGAGGGCATTCGATACC
GCAAAAACGAAGTCTTTCTCGACGTTGTTGAGTCGCTCAACCTCTTGGTCGGCGCGTCTGGCAACGTGCTCCGCT
CCGAGATTCTCGGCGCCATCAAGATGAAGTGCTACCTCAGCGGCATGCCCGAGCTGCGCCTCGGCCTCAACGACA
AGGTCATGTTTGAGACGACGGGCCGGGCCACGCGCGGCAAGGCCATTGAAATGGAAGACGTCAAGTTCCACCAAT
GCGTCCGCCTGTCGCGCTTCGAAAACGACCGCACCATATCCTTCATCCCCCCCGACGGCGAGTTTGAGCTCATGT
CGTACCGCCTCAACACCCAGGTCAAGCCCCTTATTTGGGTCGAGTGCCTCGTCGAGTCGCACTCTGGCTCGCGCA
TCGAGTACATGCTCAAGGCCAAGGCCCAGTTCAAGCGCCGCAGCACCGCCAACAATGTCGAAATCATTGTCCCCG
TCCCCGACGACGCCGACTCGCCTCGCTTCCGCACAAACATTGGCGCCGTCCACTACGCCCCCGAACAGAGCGCCA
TTGTCTGGAAGATCAAGCAGTTTGGCGGCCAAAAAGAATTCCTCATGCGCGCCGAGCTCGGCCTGCCTTCGGTCC
GTGGCGACGACGAAGTAGGAGGCGGCATGACGGGTGGCTTTGGCGGCAGCATGGGCGGCGTCGGCGTCGGCAAGG
GAGCCAAGCGCCCCATACAAGTCAAGTTTGAGATTCCTTATTTCACCACGAGCGGCATCCAGGTGCGCTACCTCA
AAATCACAGAGCCCAAGGTACACCCGCTCTTTGCAATTTTGTTCTCTCTCTTCCCTTTACCCATTAGCCTCTCTG
CTGACTCTGGCTAGCTTCAATATCCGTCGCTTCCGTGGGTTCGTTACATTACACAATCGGGCGACATTGCCGTGC
GCCTACCAGAAGTCGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail