Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3148
Gene name
LocationContig_231:5510..7328
Strand-
Gene length (bp)1818
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05141 DIT1_PvcA Pyoverdine/dityrosine biosynthesis protein 6.6E-82 42 304
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 6.1E-19 351 602

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21623|DIT1_YEAST Spore wall maturation protein DIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT1 PE=1 SV=2 31 286 2.0E-17

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup899
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2529
Ophiocordyceps australis 1348a (Ghana) OphauG2|2557
Ophiocordyceps australis 1348a (Ghana) OphauG2|3148 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1785
Ophiocordyceps australis map64 (Brazil) OphauB2|985
Ophiocordyceps australis map64 (Brazil) OphauB2|986
Ophiocordyceps camponoti-rufipedis Ophun1|7329
Ophiocordyceps subramaniannii Hirsu2|5853

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3148
MAQKPVRDKSNAIFSILCKYRMQHHDVGLKNWSRNGPFLDQIAAFVSANEPVRLLLPAFPFKSPNRTDKVLGALP
DAGEEVALMHLNGMAAAIGDAYEPGAKVLVVSDGLIYNDILGVDDEQVWDYGQVLRQLAKRNRLDHLDFLRQNDF
AQVECSSKEEYLRNAAKIRQKILQQMPQDLDFDTIVATDADLILTYRGYIRFLKLDLAQDCISMTKARREKRIKE
AARKMVLRGWAFRTAIIAKYPDCIRLSIHPSVAASKISMCLVPQQGRVQTPWHSALVRAVDGTITMSHVTRVNNL
THELIFEHGRPWYFREKSDLFSWPGLDVSFKYLYPTGILISASSPDTSYSLREVPMQKIRRLATLCSPVVLRGFS
ETTDQEVFNNRAFDLGEPAPWTHGLRTSIKNAPGENPDPALAIVTSNEAMPMHQDGFFYLVPKIQPDGTTTMVSS
QPRYQYLSAVSPSTPGSGYTLFASSARLFKNLPAPHTVDELKKLTWDCRHSCNWEHHMNHLPLVTAHPETGENCL
RLLEPWPQCKTKFAYNKVSIENGPCWYLDMLTDMLYDHRVTLRFAWEKGDVLVSDNVNMLHARTAFSATEPRELW
RIHVN*
Coding >OphauG2|3148
ATGGCTCAGAAGCCGGTGAGGGACAAGAGCAATGCCATTTTTAGTATCCTATGCAAGTATCGTATGCAGCATCAC
GACGTCGGTCTCAAAAACTGGTCACGCAATGGTCCGTTTTTGGATCAAATTGCTGCATTCGTTTCAGCCAACGAG
CCTGTTCGTCTTCTTCTACCGGCATTTCCATTTAAATCTCCGAACCGGACGGATAAAGTCCTGGGAGCTCTGCCT
GATGCTGGCGAGGAGGTGGCATTGATGCATCTCAATGGCATGGCAGCTGCCATTGGGGATGCTTATGAGCCCGGA
GCAAAGGTTCTTGTTGTATCTGATGGACTAATATACAACGATATTCTCGGGGTGGACGATGAACAAGTCTGGGAC
TATGGCCAAGTGCTCCGGCAGCTTGCAAAAAGAAACCGCCTCGACCATTTGGATTTCTTGCGCCAGAATGATTTT
GCTCAGGTTGAATGCTCGTCAAAGGAAGAATATTTGCGCAATGCTGCCAAAATTCGCCAGAAAATCCTCCAACAG
ATGCCACAAGACCTGGATTTTGACACGATAGTGGCAACTGATGCTGATTTAATCCTGACGTATCGCGGATATATC
CGGTTCCTAAAGCTCGACCTTGCCCAGGATTGCATCAGCATGACCAAGGCAAGGAGAGAGAAGCGTATCAAAGAG
GCTGCCAGGAAAATGGTCCTCCGCGGATGGGCATTCCGGACTGCCATTATCGCCAAGTATCCCGACTGCATTCGA
CTTTCTATCCATCCATCCGTGGCGGCCTCCAAGATTTCTATGTGTTTGGTTCCTCAGCAAGGCCGTGTGCAGACT
CCATGGCATTCGGCCCTTGTTCGTGCAGTTGATGGAACAATTACAATGTCTCACGTTACCCGGGTAAACAACTTG
ACCCATGAACTCATTTTCGAACATGGTCGTCCTTGGTATTTCCGCGAGAAGTCCGATTTGTTCAGCTGGCCCGGG
TTGGACGTGAGCTTCAAGTATCTATATCCGACGGGTATCTTGATATCGGCTAGCAGCCCGGATACATCGTACTCT
TTAAGAGAGGTGCCGATGCAAAAGATTCGAAGACTTGCTACGCTTTGCTCGCCAGTGGTACTTCGAGGATTCAGT
GAGACTACAGACCAAGAGGTGTTTAACAATCGGGCCTTTGATTTGGGAGAGCCAGCACCGTGGACGCATGGCCTT
CGGACTTCGATTAAAAACGCACCTGGCGAGAATCCAGATCCTGCGCTCGCAATTGTAACGAGCAACGAGGCCATG
CCTATGCATCAAGATGGCTTCTTCTACCTGGTCCCCAAGATACAGCCGGATGGCACAACCACCATGGTATCTTCA
CAGCCTCGATATCAATACTTGTCAGCAGTCTCACCGTCAACACCAGGCTCAGGGTACACGCTGTTCGCTTCTTCG
GCACGCTTGTTCAAGAACCTGCCAGCACCTCATACCGTCGACGAGCTCAAGAAGTTGACATGGGACTGTCGACAC
TCGTGCAACTGGGAACACCATATGAATCACCTCCCCTTGGTCACTGCTCACCCAGAAACTGGCGAGAACTGCCTC
AGGCTTCTCGAACCTTGGCCGCAATGCAAGACCAAGTTTGCCTATAATAAAGTCTCGATTGAAAATGGGCCGTGC
TGGTATCTCGATATGCTCACTGACATGCTGTACGACCATCGGGTAACTCTGCGTTTTGCGTGGGAAAAGGGCGAT
GTTCTCGTGTCAGACAATGTGAATATGCTGCACGCTCGTACTGCTTTTAGCGCTACCGAGCCCCGTGAGCTCTGG
CGCATTCACGTTAATTAG
Transcript >OphauG2|3148
ATGGCTCAGAAGCCGGTGAGGGACAAGAGCAATGCCATTTTTAGTATCCTATGCAAGTATCGTATGCAGCATCAC
GACGTCGGTCTCAAAAACTGGTCACGCAATGGTCCGTTTTTGGATCAAATTGCTGCATTCGTTTCAGCCAACGAG
CCTGTTCGTCTTCTTCTACCGGCATTTCCATTTAAATCTCCGAACCGGACGGATAAAGTCCTGGGAGCTCTGCCT
GATGCTGGCGAGGAGGTGGCATTGATGCATCTCAATGGCATGGCAGCTGCCATTGGGGATGCTTATGAGCCCGGA
GCAAAGGTTCTTGTTGTATCTGATGGACTAATATACAACGATATTCTCGGGGTGGACGATGAACAAGTCTGGGAC
TATGGCCAAGTGCTCCGGCAGCTTGCAAAAAGAAACCGCCTCGACCATTTGGATTTCTTGCGCCAGAATGATTTT
GCTCAGGTTGAATGCTCGTCAAAGGAAGAATATTTGCGCAATGCTGCCAAAATTCGCCAGAAAATCCTCCAACAG
ATGCCACAAGACCTGGATTTTGACACGATAGTGGCAACTGATGCTGATTTAATCCTGACGTATCGCGGATATATC
CGGTTCCTAAAGCTCGACCTTGCCCAGGATTGCATCAGCATGACCAAGGCAAGGAGAGAGAAGCGTATCAAAGAG
GCTGCCAGGAAAATGGTCCTCCGCGGATGGGCATTCCGGACTGCCATTATCGCCAAGTATCCCGACTGCATTCGA
CTTTCTATCCATCCATCCGTGGCGGCCTCCAAGATTTCTATGTGTTTGGTTCCTCAGCAAGGCCGTGTGCAGACT
CCATGGCATTCGGCCCTTGTTCGTGCAGTTGATGGAACAATTACAATGTCTCACGTTACCCGGGTAAACAACTTG
ACCCATGAACTCATTTTCGAACATGGTCGTCCTTGGTATTTCCGCGAGAAGTCCGATTTGTTCAGCTGGCCCGGG
TTGGACGTGAGCTTCAAGTATCTATATCCGACGGGTATCTTGATATCGGCTAGCAGCCCGGATACATCGTACTCT
TTAAGAGAGGTGCCGATGCAAAAGATTCGAAGACTTGCTACGCTTTGCTCGCCAGTGGTACTTCGAGGATTCAGT
GAGACTACAGACCAAGAGGTGTTTAACAATCGGGCCTTTGATTTGGGAGAGCCAGCACCGTGGACGCATGGCCTT
CGGACTTCGATTAAAAACGCACCTGGCGAGAATCCAGATCCTGCGCTCGCAATTGTAACGAGCAACGAGGCCATG
CCTATGCATCAAGATGGCTTCTTCTACCTGGTCCCCAAGATACAGCCGGATGGCACAACCACCATGGTATCTTCA
CAGCCTCGATATCAATACTTGTCAGCAGTCTCACCGTCAACACCAGGCTCAGGGTACACGCTGTTCGCTTCTTCG
GCACGCTTGTTCAAGAACCTGCCAGCACCTCATACCGTCGACGAGCTCAAGAAGTTGACATGGGACTGTCGACAC
TCGTGCAACTGGGAACACCATATGAATCACCTCCCCTTGGTCACTGCTCACCCAGAAACTGGCGAGAACTGCCTC
AGGCTTCTCGAACCTTGGCCGCAATGCAAGACCAAGTTTGCCTATAATAAAGTCTCGATTGAAAATGGGCCGTGC
TGGTATCTCGATATGCTCACTGACATGCTGTACGACCATCGGGTAACTCTGCGTTTTGCGTGGGAAAAGGGCGAT
GTTCTCGTGTCAGACAATGTGAATATGCTGCACGCTCGTACTGCTTTTAGCGCTACCGAGCCCCGTGAGCTCTGG
CGCATTCACGTTAATTAG
Gene >OphauG2|3148
ATGGCTCAGAAGCCGGTGAGGGACAAGAGCAATGCCATTTTTAGTATCCTATGCAAGTATCGTATGCAGCATCAC
GACGTCGGTCTCAAAAACTGGTCACGCAATGGTCCGTTTTTGGATCAAATTGCTGCATTCGTTTCAGCCAACGAG
CCTGTTCGTCTTCTTCTACCGGCATTTCCATTTAAATCTCCGAACCGGACGGATAAAGTCCTGGGAGCTCTGCCT
GATGCTGGCGAGGAGGTGGCATTGATGCATCTCAATGGCATGGCAGCTGCCATTGGGGATGCTTATGAGCCCGGA
GCAAAGGTTCTTGTTGTATCTGATGGACTAATATACAACGATATTCTCGGGGTGGACGATGAACAAGTCTGGGAC
TATGGCCAAGTGCTCCGGCAGCTTGCAAAAAGAAACCGCCTCGACCATTTGGATTTCTTGCGCCAGAATGATTTT
GCTCAGGTTGAATGCTCGTCAAAGGAAGAATATTTGCGCAATGCTGCCAAAATTCGCCAGAAAATCCTCCAACAG
ATGCCACAAGACCTGGATTTTGACACGATAGTGGCAACTGATGCTGATTTAATCCTGACGTATCGCGGATATATC
CGGTTCCTAAAGCTCGACCTTGCCCAGGATTGCATCAGCATGACCAAGGCAAGGAGAGAGAAGCGTATCAAAGAG
GCTGCCAGGAAAATGGTCCTCCGCGGATGGGCATTCCGGACTGCCATTATCGCCAAGTATCCCGACTGCATTCGA
CTTTCTATCCATCCATCCGTGGCGGCCTCCAAGATTTCTATGTGTTTGGTTCCTCAGCAAGGCCGTGTGCAGACT
CCATGGCATTCGGCCCTTGTTCGTGCAGTTGATGGAACAATTACAATGTCTCACGTTACCCGGGTAAACAACTTG
ACCCATGAACTCATTTTCGAACATGGTCGTCCTTGGTATTTCCGCGAGAAGTCCGATTTGTTCAGCTGGCCCGGG
TTGGACGTGAGCTTCAAGTATCTATATCCGACGGGTATCTTGATATCGGCTAGCAGCCCGGATACATCGTACTCT
TTAAGAGAGGTGCCGATGCAAAAGATTCGAAGACTTGCTACGCTTTGCTCGCCAGTGGTACTTCGAGGATTCAGT
GAGACTACAGACCAAGAGGTGTTTAACAATCGGGCCTTTGATTTGGGAGAGCCAGCACCGTGGACGCATGGCCTT
CGGACTTCGATTAAAAACGCACCTGGCGAGAATCCAGATCCTGCGCTCGCAATTGTAACGAGCAACGAGGCCATG
CCTATGCATCAAGATGGCTTCTTCTACCTGGTCCCCAAGATACAGCCGGATGGCACAACCACCATGGTATCTTCA
CAGCCTCGATATCAATACTTGTCAGCAGTCTCACCGTCAACACCAGGCTCAGGGTACACGCTGTTCGCTTCTTCG
GCACGCTTGTTCAAGAACCTGCCAGCACCTCATACCGTCGACGAGCTCAAGAAGTTGACATGGGACTGTCGACAC
TCGTGCAACTGGGAACACCATATGAATCACCTCCCCTTGGTCACTGCTCACCCAGAAACTGGCGAGAACTGCCTC
AGGCTTCTCGAACCTTGGCCGCAATGCAAGACCAAGTTTGCCTATAATAAAGTCTCGATTGAAAATGGGCCGTGC
TGGTATCTCGATATGCTCACTGACATGCTGTACGACCATCGGGTAACTCTGCGTTTTGCGTGGGAAAAGGGCGAT
GTTCTCGTGTCAGACAATGTGAATATGCTGCACGCTCGTACTGCTTTTAGCGCTACCGAGCCCCGTGAGCTCTGG
CGCATTCACGTTAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail