Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3146
Gene name
LocationContig_231:292..1658
Strand-
Gene length (bp)1366
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08618 Opi1 Transcription factor Opi1 1.5E-29 183 362
PF08618 Opi1 Transcription factor Opi1 5.9E-08 370 418

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01306|CCG8_NEUCR Clock-controlled protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccg-8 PE=2 SV=3 14 416 3.0E-73

GO

GO Term Description Terminal node
GO:0003714 transcription corepressor activity Yes
GO:0140110 transcription regulator activity No
GO:0003674 molecular_function No
GO:0003712 transcription coregulator activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3269
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3146 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1784
Ophiocordyceps camponoti-floridani Ophcf2|03556
Ophiocordyceps camponoti-rufipedis Ophun1|3610
Ophiocordyceps kimflemingae Ophio5|3280
Ophiocordyceps subramaniannii Hirsu2|596

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3146
MDIDARSVTSPTPDRQFDAVNIDDPDVRLAAEALGHLRADFVSSPPDTACLSMSPTSAHPTPPASTPKSDPPEPL
LSLLTTSHPLVASTIGGASSAYGGAKNFSPRFKSGAEYVEGYLTPIANTVNSVGRATGVEGGVRWFLNNRRQHDS
DSSGGVKKRRKFSNTRDSTIQAATDQLCMLKQYSLDDFPRTPRRLSSTSTVETLPAYDEVRSPAYTETAAPQDGP
RSVPPSAAWPSRLMMSTSGLSVSMSAESLRSLKYCLRWLRWTNDHMGRVTGNLKAALEEYENASTSATNSPTHQS
LSPQLPQVSRAELANRINSLKGDIVKTLQDAINTVSKYAGGALPENARVLVRRHLTSLPQRFKLATMVSDQDDNV
DSESALYEGAQKVLVLAKEGLDMVTQISGVVDGTIVSAEQWCERMGKRKSREASTEMSDKTS*
Coding >OphauG2|3146
ATGGATATCGATGCCAGAAGCGTCACCAGTCCCACCCCCGACCGCCAATTCGATGCTGTCAACATTGATGATCCC
GACGTTCGACTTGCCGCCGAGGCCTTGGGCCATCTCCGAGCAGACTTTGTCTCCTCGCCCCCAGACACGGCTTGC
CTTTCAATGAGCCCCACGAGTGCACACCCGACACCCCCGGCATCAACCCCCAAGTCGGACCCTCCAGAGCCTCTG
CTCTCACTGCTCACCACGTCACATCCCTTGGTCGCAAGCACCATAGGAGGCGCCAGTTCGGCATATGGCGGCGCC
AAGAACTTCTCCCCTCGCTTCAAGTCGGGCGCCGAGTACGTGGAGGGCTATCTCACTCCAATTGCAAATACTGTA
AACTCTGTTGGCCGCGCTACCGGTGTCGAGGGCGGTGTACGGTGGTTTCTCAACAACCGTCGTCAACACGACTCG
GATTCTTCAGGCGGTGTCAAAAAACGCCGCAAGTTTTCCAATACCCGAGACTCGACTATCCAAGCCGCCACAGAC
CAACTCTGCATGTTGAAACAGTACTCGCTCGATGACTTCCCCCGTACCCCGCGTCGTCTATCCTCGACGAGCACT
GTCGAAACGCTGCCCGCCTACGATGAAGTACGCTCGCCCGCCTATACAGAAACAGCTGCACCACAAGATGGCCCG
CGATCTGTCCCACCATCAGCCGCCTGGCCGTCTCGTTTAATGATGTCCACATCTGGCCTTAGCGTCTCGATGAGT
GCCGAGTCCTTGCGAAGCCTCAAATACTGCTTGCGCTGGTTGCGCTGGACCAATGACCACATGGGTCGAGTAACT
GGAAATCTCAAGGCGGCCCTCGAGGAATACGAAAATGCAAGCACATCGGCGACAAACTCGCCAACCCATCAATCA
TTGTCTCCACAATTGCCCCAGGTTTCCCGGGCCGAACTGGCCAATCGTATCAACTCGCTCAAAGGGGACATTGTC
AAGACGCTGCAAGACGCCATCAACACCGTGTCCAAGTACGCTGGTGGCGCTCTGCCCGAAAATGCCCGCGTCCTG
GTGCGACGCCACCTGACGAGCCTTCCCCAGCGCTTCAAGCTGGCCACCATGGTTAGCGACCAAGACGACAATGTC
GACAGCGAGTCGGCCTTGTACGAGGGCGCACAAAAGGTGCTTGTGCTAGCCAAGGAGGGGCTGGACATGGTGACG
CAAATATCCGGAGTCGTTGATGGCACCATTGTCAGTGCCGAGCAGTGGTGCGAGCGCATGGGCAAGAGAAAGTCG
AGAGAAGCATCCACTGAGATGAGCGACAAGACGAGTTGA
Transcript >OphauG2|3146
ATGGATATCGATGCCAGAAGCGTCACCAGTCCCACCCCCGACCGCCAATTCGATGCTGTCAACATTGATGATCCC
GACGTTCGACTTGCCGCCGAGGCCTTGGGCCATCTCCGAGCAGACTTTGTCTCCTCGCCCCCAGACACGGCTTGC
CTTTCAATGAGCCCCACGAGTGCACACCCGACACCCCCGGCATCAACCCCCAAGTCGGACCCTCCAGAGCCTCTG
CTCTCACTGCTCACCACGTCACATCCCTTGGTCGCAAGCACCATAGGAGGCGCCAGTTCGGCATATGGCGGCGCC
AAGAACTTCTCCCCTCGCTTCAAGTCGGGCGCCGAGTACGTGGAGGGCTATCTCACTCCAATTGCAAATACTGTA
AACTCTGTTGGCCGCGCTACCGGTGTCGAGGGCGGTGTACGGTGGTTTCTCAACAACCGTCGTCAACACGACTCG
GATTCTTCAGGCGGTGTCAAAAAACGCCGCAAGTTTTCCAATACCCGAGACTCGACTATCCAAGCCGCCACAGAC
CAACTCTGCATGTTGAAACAGTACTCGCTCGATGACTTCCCCCGTACCCCGCGTCGTCTATCCTCGACGAGCACT
GTCGAAACGCTGCCCGCCTACGATGAAGTACGCTCGCCCGCCTATACAGAAACAGCTGCACCACAAGATGGCCCG
CGATCTGTCCCACCATCAGCCGCCTGGCCGTCTCGTTTAATGATGTCCACATCTGGCCTTAGCGTCTCGATGAGT
GCCGAGTCCTTGCGAAGCCTCAAATACTGCTTGCGCTGGTTGCGCTGGACCAATGACCACATGGGTCGAGTAACT
GGAAATCTCAAGGCGGCCCTCGAGGAATACGAAAATGCAAGCACATCGGCGACAAACTCGCCAACCCATCAATCA
TTGTCTCCACAATTGCCCCAGGTTTCCCGGGCCGAACTGGCCAATCGTATCAACTCGCTCAAAGGGGACATTGTC
AAGACGCTGCAAGACGCCATCAACACCGTGTCCAAGTACGCTGGTGGCGCTCTGCCCGAAAATGCCCGCGTCCTG
GTGCGACGCCACCTGACGAGCCTTCCCCAGCGCTTCAAGCTGGCCACCATGGTTAGCGACCAAGACGACAATGTC
GACAGCGAGTCGGCCTTGTACGAGGGCGCACAAAAGGTGCTTGTGCTAGCCAAGGAGGGGCTGGACATGGTGACG
CAAATATCCGGAGTCGTTGATGGCACCATTGTCAGTGCCGAGCAGTGGTGCGAGCGCATGGGCAAGAGAAAGTCG
AGAGAAGCATCCACTGAGATGAGCGACAAGACGAGTTGA
Gene >OphauG2|3146
ATGGATATCGATGCCAGAAGCGTCACCAGTCCCACCCCCGACCGCCAATTCGATGCTGTCAACATTGATGATCCC
GACGTTCGACTTGCCGCCGAGGCCTTGGGCCATCTCCGAGCAGGTTGGTCGTGCACTGTGCATCCTCGTTGCTGC
CACTAATTGCTTCTGCATAGACTTTGTCTCCTCGCCCCCAGACACGGCTTGCCTTTCAATGAGCCCCACGAGTGC
ACACCCGACACCCCCGGCATCAACCCCCAAGTCGGACCCTCCAGAGCCTCTGCTCTCACTGCTCACCACGTCACA
TCCCTTGGTCGCAAGCACCATAGGAGGCGCCAGTTCGGCATATGGCGGCGCCAAGAACTTCTCCCCTCGCTTCAA
GTCGGGCGCCGAGTACGTGGAGGGCTATCTCACTCCAATTGCAAATACTGTAAACTCTGTTGGCCGCGCTACCGG
TGTCGAGGGCGGTGTACGGTGGTTTCTCAACAACCGTCGTCAACACGACTCGGATTCTTCAGGCGGTGTCAAAAA
ACGCCGCAAGTTTTCCAATACCCGAGACTCGACTATCCAAGCCGCCACAGACCAACTCTGCATGTTGAAACAGTA
CTCGCTCGATGACTTCCCCCGTACCCCGCGTCGTCTATCCTCGACGAGCACTGTCGAAACGCTGCCCGCCTACGA
TGAAGTACGCTCGCCCGCCTATACAGAAACAGCTGCACCACAAGATGGCCCGCGATCTGTCCCACCATCAGCCGC
CTGGCCGTCTCGTTTAATGATGTCCACATCTGGCCTTAGCGTCTCGATGAGTGCCGAGTCCTTGCGAAGCCTCAA
ATACTGCTTGCGCTGGTTGCGCTGGACCAATGACCACATGGGTCGAGTAACTGGAAATCTCAAGGCGGCCCTCGA
GGAATACGAAAATGCAAGCACATCGGCGACAAACTCGCCAACCCATCAATCATTGTCTCCACAATTGCCCCAGGT
TTCCCGGGCCGAACTGGCCAATCGTATCAACTCGCTCAAAGGGGACATTGTCAAGACGCTGCAAGACGCCATCAA
CACCGTGTCCAAGTACGCTGGTGGCGCTCTGCCCGAAAATGCCCGCGTCCTGGTGCGACGCCACCTGACGAGCCT
TCCCCAGCGCTTCAAGCTGGCCACCATGGTTAGCGACCAAGACGACAATGTCGACAGCGAGTCGGCCTTGTACGA
GGGCGCACAAAAGGTGCTTGTGCTAGCCAAGGAGGGGCTGGACATGGTGACGCAAATATCCGGAGTCGTTGATGG
CACCATTGTCAGTGCCGAGCAGTGGTGCGAGCGCATGGGCAAGAGAAAGTCGAGAGAAGCATCCACTGAGATGAG
CGACAAGACGAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail