© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|3136 |
| Gene name | |
| Location | Contig_23:52049..53807 |
| Strand | - |
| Gene length (bp) | 1758 |
| Transcript length (bp) | 1548 |
| Coding sequence length (bp) | 1548 |
| Protein length (aa) | 516 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 2.6E-54 | 46 | 501 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 31 | 482 | 2.0E-54 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 1 | 482 | 4.0E-49 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 29 | 510 | 4.0E-38 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 6 | 486 | 1.0E-28 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 6 | 486 | 1.0E-28 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 31 | 482 | 2.0E-54 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 1 | 482 | 4.0E-49 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 29 | 510 | 4.0E-38 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 6 | 486 | 1.0E-28 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 6 | 486 | 1.0E-28 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 18 | 482 | 6.0E-28 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 64 | 484 | 3.0E-27 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 33 | 486 | 3.0E-27 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 64 | 512 | 1.0E-26 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 5 | 486 | 1.0E-25 |
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 16 | 498 | 1.0E-23 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 83 | 487 | 7.0E-21 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 129 | 486 | 5.0E-20 |
| sp|Q9STL0|C71AN_ARATH | Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 | 129 | 481 | 1.0E-19 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 129 | 481 | 3.0E-19 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 24 | 492 | 6.0E-19 |
| sp|O17624|C13B1_CAEEL | Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 | 153 | 504 | 1.0E-18 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 244 | 510 | 2.0E-18 |
| sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 23 | 511 | 3.0E-18 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 12 | 485 | 4.0E-18 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 12 | 485 | 5.0E-18 |
| sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 33 | 484 | 7.0E-18 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 151 | 492 | 7.0E-18 |
| sp|O81117|C94A1_VICSA | Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 | 231 | 511 | 1.0E-17 |
| sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 25 | 490 | 2.0E-17 |
| sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 142 | 491 | 3.0E-17 |
| sp|Q9STK8|C71AP_ARATH | Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 | 129 | 486 | 5.0E-17 |
| sp|O23066|C86A2_ARATH | Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 | 274 | 511 | 5.0E-17 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 129 | 481 | 5.0E-17 |
| sp|Q9STK9|C71AO_ARATH | Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 | 129 | 486 | 8.0E-17 |
| sp|Q9STL2|C71AL_ARATH | Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 | 129 | 486 | 9.0E-17 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 24 | 482 | 1.0E-16 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 113 | 481 | 2.0E-16 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 53 | 490 | 2.0E-16 |
| sp|Q9ZUX1|C94C1_ARATH | Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 | 262 | 487 | 3.0E-16 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 129 | 484 | 3.0E-16 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 203 | 484 | 4.0E-16 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 244 | 490 | 5.0E-16 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 172 | 506 | 5.0E-16 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 85 | 490 | 6.0E-16 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 152 | 477 | 9.0E-16 |
| sp|Q54DT2|C516A_DICDI | Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 | 167 | 480 | 1.0E-15 |
| sp|B3RFJ6|86A22_PETHY | Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 | 275 | 511 | 1.0E-15 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 13 | 485 | 1.0E-15 |
| sp|E3W9C4|C71A1_ZINZE | Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 | 286 | 481 | 1.0E-15 |
| sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 244 | 490 | 2.0E-15 |
| sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 12 | 494 | 2.0E-15 |
| sp|Q9LMM1|C86A4_ARATH | Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 | 281 | 511 | 2.0E-15 |
| sp|Q9VMT6|C28D2_DROME | Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 | 281 | 492 | 2.0E-15 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 129 | 461 | 3.0E-15 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 129 | 509 | 3.0E-15 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 310 | 484 | 4.0E-15 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 137 | 515 | 4.0E-15 |
| sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 281 | 511 | 5.0E-15 |
| sp|Q16850|CP51A_HUMAN | Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 | 258 | 512 | 6.0E-15 |
| sp|Q4R8S6|CP51A_MACFA | Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 | 258 | 512 | 7.0E-15 |
| sp|Q5RE72|CP51A_PONAB | Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 | 258 | 512 | 7.0E-15 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 244 | 490 | 7.0E-15 |
| sp|O46420|CP51A_PIG | Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 | 310 | 512 | 8.0E-15 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 104 | 490 | 8.0E-15 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 129 | 461 | 1.0E-14 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 69 | 484 | 1.0E-14 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 244 | 490 | 2.0E-14 |
| sp|P48422|C86A1_ARATH | Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 | 281 | 482 | 2.0E-14 |
| sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 312 | 501 | 2.0E-14 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 19 | 480 | 2.0E-14 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 310 | 486 | 2.0E-14 |
| sp|Q27515|C13A6_CAEEL | Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 | 312 | 511 | 2.0E-14 |
| sp|Q8K0C4|CP51A_MOUSE | Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 | 258 | 512 | 3.0E-14 |
| sp|Q5KQH7|C14D1_ORYSJ | Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 | 180 | 509 | 3.0E-14 |
| sp|Q4PJW3|CP51A_BOVIN | Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 | 336 | 512 | 3.0E-14 |
| sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 244 | 493 | 3.0E-14 |
| sp|O80823|C86A8_ARATH | Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 | 281 | 511 | 3.0E-14 |
| sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 260 | 505 | 4.0E-14 |
| sp|Q64654|CP51A_RAT | Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 | 338 | 512 | 4.0E-14 |
| sp|P37117|C71A4_SOLME | Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 | 174 | 484 | 4.0E-14 |
| sp|Q50EK3|C04C1_PINTA | Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 | 241 | 477 | 5.0E-14 |
| sp|Q9VMT5|C28D1_DROME | Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 | 281 | 492 | 6.0E-14 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 191 | 477 | 8.0E-14 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 310 | 508 | 9.0E-14 |
| sp|Q91Z85|CP17A_PERLE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 | 51 | 509 | 9.0E-14 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 63 | 515 | 1.0E-13 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 249 | 480 | 1.0E-13 |
| sp|Q9UVC3|CP51_CUNEL | Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 | 279 | 501 | 2.0E-13 |
| sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 310 | 480 | 2.0E-13 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 245 | 509 | 2.0E-13 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 251 | 482 | 2.0E-13 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 244 | 514 | 2.0E-13 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 281 | 482 | 2.0E-13 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 240 | 481 | 3.0E-13 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 36 | 480 | 4.0E-13 |
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 310 | 489 | 4.0E-13 |
| sp|Q9VFJ0|CA131_DROME | Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 | 310 | 483 | 5.0E-13 |
| sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 80 | 501 | 5.0E-13 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 227 | 509 | 5.0E-13 |
| sp|Q09660|CC44_CAEEL | Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 | 266 | 482 | 6.0E-13 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 19 | 510 | 7.0E-13 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 19 | 508 | 7.0E-13 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 29 | 484 | 7.0E-13 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 310 | 481 | 7.0E-13 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 129 | 481 | 7.0E-13 |
| sp|P58047|C71AS_ARATH | Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2 | 129 | 481 | 7.0E-13 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 51 | 509 | 7.0E-13 |
| sp|B9G934|C14C3_ORYSJ | Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 | 312 | 480 | 8.0E-13 |
| sp|P98188|C94A2_VICSA | Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 | 301 | 510 | 9.0E-13 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 302 | 480 | 9.0E-13 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 232 | 482 | 1.0E-12 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 310 | 489 | 1.0E-12 |
| sp|H2DH18|C7A12_PANGI | Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 | 270 | 481 | 1.0E-12 |
| sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 232 | 482 | 1.0E-12 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 243 | 485 | 2.0E-12 |
| sp|P0DKI7|STORR_PAPSO | Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 | 218 | 492 | 2.0E-12 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 281 | 510 | 2.0E-12 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 227 | 509 | 2.0E-12 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 310 | 508 | 2.0E-12 |
| sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 151 | 483 | 2.0E-12 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 232 | 483 | 2.0E-12 |
| sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 281 | 482 | 2.0E-12 |
| sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 281 | 483 | 2.0E-12 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 310 | 480 | 2.0E-12 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 66 | 482 | 3.0E-12 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 310 | 476 | 3.0E-12 |
| sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 37 | 511 | 3.0E-12 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 310 | 481 | 3.0E-12 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 37 | 480 | 3.0E-12 |
| sp|Q54SV9|C515B_DICDI | Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 | 12 | 469 | 3.0E-12 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 186 | 477 | 3.0E-12 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 120 | 512 | 3.0E-12 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 312 | 483 | 3.0E-12 |
| sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 281 | 482 | 3.0E-12 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 302 | 480 | 3.0E-12 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 310 | 500 | 3.0E-12 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 281 | 482 | 3.0E-12 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 310 | 477 | 3.0E-12 |
| sp|Q9SWR5|C93C1_SOYBN | 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 | 210 | 491 | 3.0E-12 |
| sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 185 | 481 | 4.0E-12 |
| sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 258 | 482 | 4.0E-12 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 310 | 480 | 4.0E-12 |
| sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 243 | 514 | 4.0E-12 |
| sp|Q27514|C13A5_CAEEL | Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 | 310 | 480 | 4.0E-12 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 310 | 507 | 4.0E-12 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 310 | 480 | 5.0E-12 |
| sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 33 | 492 | 5.0E-12 |
| sp|P10615|CP52A_CANTR | Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 | 307 | 468 | 5.0E-12 |
| sp|G4XV71|C93C2_GLYUR | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 | 210 | 491 | 6.0E-12 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 310 | 481 | 6.0E-12 |
| sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 129 | 481 | 6.0E-12 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 306 | 510 | 6.0E-12 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 281 | 480 | 7.0E-12 |
| sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 281 | 482 | 7.0E-12 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 281 | 491 | 7.0E-12 |
| sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 307 | 477 | 7.0E-12 |
| sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 310 | 480 | 7.0E-12 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 272 | 500 | 8.0E-12 |
| sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 312 | 480 | 9.0E-12 |
| sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 281 | 491 | 1.0E-11 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 175 | 482 | 1.0E-11 |
| sp|Q9SXS3|C93C2_GLYEC | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 | 210 | 491 | 1.0E-11 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 281 | 484 | 1.0E-11 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 34 | 480 | 1.0E-11 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 310 | 476 | 1.0E-11 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 310 | 500 | 1.0E-11 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 281 | 483 | 2.0E-11 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 268 | 489 | 2.0E-11 |
| sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 313 | 477 | 2.0E-11 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 244 | 480 | 2.0E-11 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 279 | 509 | 3.0E-11 |
| sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 312 | 483 | 3.0E-11 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 302 | 480 | 3.0E-11 |
| sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 152 | 480 | 4.0E-11 |
| sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 171 | 513 | 4.0E-11 |
| sp|B1NF19|C719D_ARGME | (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 | 311 | 477 | 4.0E-11 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 310 | 482 | 4.0E-11 |
| sp|O65438|C71AR_ARATH | Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 | 37 | 481 | 4.0E-11 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 59 | 482 | 4.0E-11 |
| sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 246 | 500 | 4.0E-11 |
| sp|O65787|C71B6_ARATH | Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 | 188 | 481 | 5.0E-11 |
| sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 307 | 468 | 5.0E-11 |
| sp|Q9QZ82|CP11A_MOUSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 | 294 | 502 | 5.0E-11 |
| sp|H2DH17|C7A22_PANGI | Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 | 240 | 484 | 5.0E-11 |
| sp|Q7Z1V1|CP51_TRYCC | Sterol 14-alpha demethylase OS=Trypanosoma cruzi (strain CL Brener) GN=CYP51 PE=1 SV=1 | 206 | 485 | 5.0E-11 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 59 | 482 | 6.0E-11 |
| sp|Q00557|CP1A1_MESAU | Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 | 11 | 492 | 6.0E-11 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 310 | 480 | 6.0E-11 |
| sp|P30610|CP52H_CANTR | Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 | 310 | 487 | 6.0E-11 |
| sp|Q9LTL0|C71BQ_ARATH | Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 | 198 | 512 | 6.0E-11 |
| sp|Q9SZ46|C82C4_ARATH | Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | 307 | 485 | 6.0E-11 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 307 | 487 | 6.0E-11 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 281 | 482 | 6.0E-11 |
| sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 266 | 484 | 7.0E-11 |
| sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 106 | 481 | 7.0E-11 |
| sp|O48922|C98A2_SOYBN | Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 | 201 | 480 | 7.0E-11 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 236 | 477 | 8.0E-11 |
| sp|Q9NYL5|CP39A_HUMAN | 24-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP39A1 PE=2 SV=2 | 294 | 501 | 8.0E-11 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 310 | 480 | 8.0E-11 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 311 | 485 | 8.0E-11 |
| sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 310 | 480 | 9.0E-11 |
| sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 312 | 501 | 9.0E-11 |
| sp|P56590|CP1A1_CANLF | Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 | 11 | 492 | 9.0E-11 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 310 | 486 | 1.0E-10 |
| sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 295 | 501 | 1.0E-10 |
| sp|P85191|CP450_HELAN | Cytochrome P450 (Fragment) OS=Helianthus annuus PE=1 SV=1 | 361 | 511 | 1.0E-10 |
| sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 129 | 477 | 1.0E-10 |
| sp|Q9SAA9|CP511_ARATH | Sterol 14-demethylase OS=Arabidopsis thaliana GN=CYP51G1 PE=1 SV=1 | 204 | 514 | 1.0E-10 |
| sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 313 | 515 | 1.0E-10 |
| sp|Q9Y7C8|LOVA_ASPTE | Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 | 191 | 512 | 1.0E-10 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 281 | 480 | 1.0E-10 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 236 | 492 | 1.0E-10 |
| sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 185 | 481 | 1.0E-10 |
| sp|Q9SAB6|C71AI_ARATH | Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 | 129 | 481 | 1.0E-10 |
| sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 294 | 501 | 1.0E-10 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 312 | 510 | 2.0E-10 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 281 | 480 | 2.0E-10 |
| sp|Q9VQD2|CP391_DROME | Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 | 311 | 482 | 2.0E-10 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 281 | 482 | 2.0E-10 |
| sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 169 | 484 | 2.0E-10 |
| sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 258 | 482 | 2.0E-10 |
| sp|Q9LUC8|C7A13_ARATH | Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 | 75 | 484 | 2.0E-10 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 11 | 482 | 2.0E-10 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 37 | 480 | 2.0E-10 |
| sp|Q9EPT4|CP11A_MESAU | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 | 294 | 501 | 2.0E-10 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 310 | 477 | 2.0E-10 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 61 | 490 | 2.0E-10 |
| sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 15 | 510 | 2.0E-10 |
| sp|Q93Z79|C14A1_ARATH | Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 | 311 | 484 | 3.0E-10 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 51 | 482 | 3.0E-10 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 310 | 476 | 3.0E-10 |
| sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 313 | 482 | 3.0E-10 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 313 | 482 | 3.0E-10 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 307 | 490 | 3.0E-10 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 51 | 482 | 3.0E-10 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 51 | 482 | 3.0E-10 |
| sp|P48420|C78A1_MAIZE | Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 | 229 | 491 | 4.0E-10 |
| sp|Q5KQT7|CP1A1_FELCA | Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 | 12 | 477 | 4.0E-10 |
| sp|Q64562|CP21A_RAT | Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 | 281 | 482 | 4.0E-10 |
| sp|P30609|CP52G_CANTR | Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 | 309 | 487 | 4.0E-10 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 51 | 482 | 5.0E-10 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 313 | 487 | 5.0E-10 |
| sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 75 | 484 | 5.0E-10 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 51 | 482 | 5.0E-10 |
| sp|Q9SMP5|C94B3_ARATH | Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 | 244 | 482 | 5.0E-10 |
| sp|B1NF18|C719B_PAPSO | Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 | 276 | 513 | 5.0E-10 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 310 | 480 | 6.0E-10 |
| sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 312 | 483 | 6.0E-10 |
| sp|O48928|C77A3_SOYBN | Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 | 14 | 515 | 6.0E-10 |
| sp|Q9FMV7|C94B1_ARATH | Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 | 310 | 482 | 7.0E-10 |
| sp|P10612|CP11A_PIG | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 | 312 | 502 | 7.0E-10 |
| sp|Q9LJY7|C75AK_ARATH | Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 | 229 | 515 | 7.0E-10 |
| sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 148 | 477 | 7.0E-10 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 4 | 486 | 7.0E-10 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 281 | 482 | 7.0E-10 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 29 | 492 | 8.0E-10 |
| sp|L7X0L7|P6H_PAPSO | Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 | 174 | 482 | 8.0E-10 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 281 | 480 | 8.0E-10 |
| sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 281 | 482 | 9.0E-10 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 310 | 513 | 9.0E-10 |
| sp|P58045|C71AE_ARATH | Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 | 129 | 481 | 1.0E-09 |
| sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 206 | 510 | 1.0E-09 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 310 | 480 | 1.0E-09 |
| sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 204 | 483 | 1.0E-09 |
| sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 310 | 482 | 1.0E-09 |
| sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 51 | 482 | 1.0E-09 |
| sp|Q6NKZ8|C14A2_ARATH | Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 | 152 | 484 | 1.0E-09 |
| sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 159 | 477 | 1.0E-09 |
| sp|F4IK45|C70B2_ARATH | Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 | 255 | 484 | 1.0E-09 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 253 | 489 | 2.0E-09 |
| sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 51 | 482 | 2.0E-09 |
| sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 50 | 482 | 2.0E-09 |
| sp|P05176|CP1A1_RABIT | Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 | 126 | 492 | 2.0E-09 |
| sp|P43083|CP52V_CANAP | Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 | 281 | 468 | 2.0E-09 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 3 | 480 | 2.0E-09 |
| sp|P79202|CP11A_SHEEP | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 | 293 | 484 | 2.0E-09 |
| sp|Q6Z6D6|C7342_ORYSJ | Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 | 235 | 482 | 2.0E-09 |
| sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 11 | 492 | 2.0E-09 |
| sp|Q92100|CP1A1_PLEPL | Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 | 312 | 477 | 2.0E-09 |
| sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 306 | 477 | 2.0E-09 |
| sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 297 | 505 | 2.0E-09 |
| sp|Q09736|CP51_SCHPO | Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 | 227 | 511 | 2.0E-09 |
| sp|Q64408|C11B1_CAVPO | Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 | 297 | 502 | 2.0E-09 |
| sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 12 | 492 | 3.0E-09 |
| sp|Q00714|STCS_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 | 310 | 483 | 3.0E-09 |
| sp|Q69XM6|C7344_ORYSJ | Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 | 75 | 484 | 3.0E-09 |
| sp|Q9VGB4|CP132_DROME | Probable cytochrome P450 313a2 OS=Drosophila melanogaster GN=Cyp313a2 PE=3 SV=3 | 293 | 510 | 4.0E-09 |
| sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 173 | 484 | 4.0E-09 |
| sp|Q64678|CP1B1_RAT | Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 | 2 | 515 | 4.0E-09 |
| sp|P21595|CP56_YEAST | Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 | 310 | 477 | 4.0E-09 |
| sp|Q9ASR3|C7091_ARATH | Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 | 277 | 477 | 4.0E-09 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 281 | 477 | 4.0E-09 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 310 | 480 | 4.0E-09 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 276 | 493 | 5.0E-09 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 253 | 481 | 5.0E-09 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 19 | 480 | 5.0E-09 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 144 | 482 | 5.0E-09 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 271 | 481 | 5.0E-09 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 248 | 486 | 5.0E-09 |
| sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 281 | 482 | 5.0E-09 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 257 | 482 | 6.0E-09 |
| sp|P15150|C11B1_BOVIN | Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 | 312 | 503 | 7.0E-09 |
| sp|Q7XHW5|C14B1_ORYSJ | Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 | 140 | 484 | 9.0E-09 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 311 | 493 | 9.0E-09 |
| sp|P93596|CP51_WHEAT | Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 | 204 | 492 | 9.0E-09 |
| sp|Q9VG40|CP134_DROME | Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 | 310 | 480 | 1.0E-08 |
| sp|P00189|CP11A_BOVIN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 | 293 | 484 | 1.0E-08 |
| sp|Q3LFU0|CP1A1_BALAC | Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 | 13 | 492 | 1.0E-08 |
| sp|P54781|ERG5_YEAST | Cytochrome P450 61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG5 PE=1 SV=1 | 310 | 511 | 1.0E-08 |
| sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 304 | 482 | 1.0E-08 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 290 | 481 | 1.0E-08 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 290 | 481 | 1.0E-08 |
| sp|P05108|CP11A_HUMAN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 | 310 | 501 | 1.0E-08 |
| sp|Q9N0U7|CP17A_CAPHI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 | 21 | 482 | 1.0E-08 |
| sp|Q9VGB5|CP135_DROME | Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 | 171 | 480 | 1.0E-08 |
| sp|O48927|C78A3_SOYBN | Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 | 253 | 481 | 2.0E-08 |
| sp|Q9ZNR0|C78A6_ARATH | Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 | 180 | 483 | 2.0E-08 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 311 | 511 | 2.0E-08 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 310 | 480 | 2.0E-08 |
| sp|P36423|THAS_MOUSE | Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 | 152 | 470 | 2.0E-08 |
| sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 198 | 481 | 2.0E-08 |
| sp|P30611|CP52N_CANTR | Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 | 310 | 489 | 2.0E-08 |
| sp|O22203|C98A3_ARATH | Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 | 193 | 480 | 2.0E-08 |
| sp|Q1ZXG6|C5131_DICDI | Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 | 152 | 510 | 2.0E-08 |
| sp|Q9JKJ9|CP39A_MOUSE | 24-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp39a1 PE=1 SV=1 | 331 | 501 | 2.0E-08 |
| sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 191 | 511 | 2.0E-08 |
| sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 149 | 488 | 3.0E-08 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 313 | 482 | 3.0E-08 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 173 | 484 | 3.0E-08 |
| sp|O49340|C71AC_ARATH | Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 | 129 | 481 | 3.0E-08 |
| sp|Q9GMC7|CP17A_BISBI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 | 51 | 482 | 3.0E-08 |
| sp|Q3LFT9|CP1A2_BALAC | Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 | 357 | 508 | 3.0E-08 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 13 | 502 | 4.0E-08 |
| sp|Q92116|CP1A1_STECH | Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 | 312 | 479 | 4.0E-08 |
| sp|O04773|C75A6_CAMME | Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 | 281 | 510 | 4.0E-08 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 11 | 511 | 4.0E-08 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 245 | 491 | 4.0E-08 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 304 | 510 | 4.0E-08 |
| sp|Q9ZW95|C7352_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 | 356 | 486 | 4.0E-08 |
| sp|Q6GUR1|CP1A1_MACMU | Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 | 11 | 492 | 5.0E-08 |
| sp|Q29497|CP17A_SHEEP | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 | 235 | 482 | 5.0E-08 |
| sp|Q948Y1|C719A_COPJA | (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 | 311 | 511 | 5.0E-08 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 276 | 482 | 5.0E-08 |
| sp|Q16647|PTGIS_HUMAN | Prostacyclin synthase OS=Homo sapiens GN=PTGIS PE=1 SV=1 | 330 | 513 | 5.0E-08 |
| sp|Q93ZB2|KO1_ARATH | Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 | 200 | 467 | 5.0E-08 |
| sp|B1NF20|C719E_ARGME | Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 | 285 | 510 | 5.0E-08 |
| sp|O02766|CP8B1_RABIT | 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Oryctolagus cuniculus GN=CYP8B1 PE=1 SV=3 | 276 | 513 | 5.0E-08 |
| sp|P56591|CP1A1_SHEEP | Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 | 357 | 492 | 6.0E-08 |
| sp|P93846|CP51_SORBI | Obtusifoliol 14-alpha demethylase OS=Sorghum bicolor GN=CYP51 PE=1 SV=1 | 204 | 492 | 6.0E-08 |
| sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 136 | 477 | 6.0E-08 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 12 | 465 | 6.0E-08 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 228 | 501 | 6.0E-08 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 191 | 481 | 6.0E-08 |
| sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 307 | 482 | 6.0E-08 |
| sp|P33616|CP1A1_MACFA | Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 | 11 | 492 | 6.0E-08 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 147 | 480 | 7.0E-08 |
| sp|Q54KV0|C513B_DICDI | Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 | 310 | 481 | 7.0E-08 |
| sp|P13107|CP2B3_RAT | Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 | 276 | 482 | 7.0E-08 |
| sp|P05185|CP17A_BOVIN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 | 51 | 482 | 7.0E-08 |
| sp|B9WZX6|FTMG_ASPFM | Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 | 303 | 510 | 7.0E-08 |
| sp|Q12573|CP52W_CANAP | Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 | 310 | 468 | 7.0E-08 |
| sp|Q9SLP1|C78A9_ARATH | Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 | 277 | 481 | 8.0E-08 |
| sp|P30100|C11B3_RAT | Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 | 297 | 505 | 8.0E-08 |
| sp|P30099|C11B2_RAT | Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 | 297 | 505 | 8.0E-08 |
| sp|Q8L7D5|THAH_ARATH | Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3 | 280 | 486 | 8.0E-08 |
| sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 313 | 510 | 9.0E-08 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 311 | 510 | 9.0E-08 |
| sp|P15393|C11B1_RAT | Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 | 306 | 502 | 9.0E-08 |
| sp|Q9VGZ0|C12E1_DROME | Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 | 303 | 487 | 1.0E-07 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 307 | 486 | 1.0E-07 |
| sp|Q12664|CP51_PENIT | Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 | 281 | 477 | 1.0E-07 |
| sp|Q9LMX7|C78A5_ARATH | Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 | 244 | 481 | 1.0E-07 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 204 | 510 | 1.0E-07 |
| sp|Q9LTM0|C71BN_ARATH | Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 | 311 | 510 | 1.0E-07 |
| sp|Q06367|CP1A1_CAVPO | Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 | 357 | 492 | 1.0E-07 |
| sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 313 | 510 | 1.0E-07 |
| sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 80 | 484 | 1.0E-07 |
| sp|Q8W4T9|T13H_TAXCU | Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1 | 245 | 492 | 2.0E-07 |
| sp|Q9LIP4|C71BX_ARATH | Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 | 145 | 485 | 2.0E-07 |
| sp|Q62969|PTGIS_RAT | Prostacyclin synthase OS=Rattus norvegicus GN=Ptgis PE=2 SV=1 | 324 | 512 | 2.0E-07 |
| sp|Q29626|PTGIS_BOVIN | Prostacyclin synthase OS=Bos taurus GN=PTGIS PE=1 SV=1 | 330 | 513 | 2.0E-07 |
| sp|O49859|C82A4_SOYBN | Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 | 226 | 482 | 2.0E-07 |
| sp|Q9LZ31|C77A4_ARATH | Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 | 312 | 515 | 2.0E-07 |
| sp|Q6UEG2|AFLN_ASPPA | P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 | 310 | 482 | 2.0E-07 |
| sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 311 | 482 | 2.0E-07 |
| sp|P19100|CP17A_PIG | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 | 51 | 484 | 2.0E-07 |
| sp|O14442|CP51_UNCNE | Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 | 226 | 477 | 2.0E-07 |
| sp|Q0DS59|C14B2_ORYSJ | Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 | 311 | 484 | 3.0E-07 |
| sp|Q9V3S0|CP4G1_DROME | Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 | 313 | 510 | 3.0E-07 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 276 | 487 | 3.0E-07 |
| sp|Q1ZXN4|C519C_DICDI | Probable cytochrome P450 519C1 OS=Dictyostelium discoideum GN=cyp519C1 PE=3 SV=1 | 306 | 486 | 3.0E-07 |
| sp|Q5Z5S6|C7019_ORYSJ | Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 | 227 | 466 | 4.0E-07 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 311 | 510 | 4.0E-07 |
| sp|Q7Y1V5|C78AB_ORYSJ | Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 | 225 | 481 | 4.0E-07 |
| sp|Q9V6D6|CP301_DROME | Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 | 303 | 482 | 4.0E-07 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 357 | 492 | 4.0E-07 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 302 | 470 | 4.0E-07 |
| sp|Q1PS23|AMO_ARTAN | Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 | 14 | 510 | 5.0E-07 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 154 | 477 | 5.0E-07 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 234 | 469 | 5.0E-07 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 281 | 481 | 5.0E-07 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 281 | 481 | 6.0E-07 |
| sp|O13345|ORDA_ASPPA | O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 | 304 | 487 | 6.0E-07 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 310 | 491 | 6.0E-07 |
| sp|Q4WAX0|FTMG_ASPFU | Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 | 303 | 486 | 7.0E-07 |
| sp|Q64429|CP1B1_MOUSE | Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 | 168 | 512 | 7.0E-07 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 312 | 481 | 7.0E-07 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 311 | 482 | 8.0E-07 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 311 | 482 | 8.0E-07 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 313 | 510 | 8.0E-07 |
| sp|P37123|C77A1_SOLME | Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 | 157 | 481 | 8.0E-07 |
| sp|Q96514|C71B7_ARATH | Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 | 180 | 481 | 8.0E-07 |
| sp|B6SSW8|C14B3_MAIZE | Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 | 312 | 492 | 8.0E-07 |
| sp|Q9SAE4|C71BT_ARATH | Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 | 288 | 486 | 9.0E-07 |
| sp|Q4H4C3|CP1A2_MACFU | Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 | 357 | 492 | 9.0E-07 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 228 | 481 | 1.0E-06 |
| sp|O77809|CP1A2_MACFA | Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 | 357 | 492 | 1.0E-06 |
| sp|Q9W223|CP6D2_DROME | Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 | 216 | 495 | 1.0E-06 |
| sp|Q9VYQ5|CP318_DROME | Probable cytochrome P450 318a1 OS=Drosophila melanogaster GN=Cyp318a1 PE=2 SV=4 | 360 | 481 | 1.0E-06 |
| sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 312 | 481 | 1.0E-06 |
| sp|Q92110|CP1A1_ONCMY | Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 | 183 | 477 | 1.0E-06 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 281 | 510 | 1.0E-06 |
| sp|Q9SP06|C80B3_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 | 312 | 484 | 1.0E-06 |
| sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 303 | 486 | 1.0E-06 |
| sp|Q9FH66|C71AG_ARATH | Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 | 129 | 481 | 2.0E-06 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 245 | 485 | 2.0E-06 |
| sp|P79716|CP1A1_DICLA | Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 | 312 | 477 | 2.0E-06 |
| sp|O57525|CP17A_RANDY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 | 304 | 486 | 2.0E-06 |
| sp|Q5KQT6|CP1A2_FELCA | Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 | 13 | 492 | 2.0E-06 |
| sp|Q9SAE3|C71BS_ARATH | Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 | 311 | 486 | 2.0E-06 |
| sp|Q2QYH7|C14C2_ORYSJ | Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 | 172 | 468 | 2.0E-06 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 310 | 486 | 2.0E-06 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 187 | 466 | 2.0E-06 |
| sp|Q0DBF4|C7018_ORYSJ | Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 | 227 | 466 | 3.0E-06 |
| sp|Q9Y8G7|C505_FUSOX | Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 | 276 | 487 | 3.0E-06 |
| sp|Q9VYT8|C28C1_DROME | Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 | 281 | 489 | 4.0E-06 |
| sp|A1DA65|FTMG_NEOFI | Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 | 303 | 510 | 4.0E-06 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 312 | 481 | 4.0E-06 |
| sp|O77810|CP1A2_CALJA | Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 | 250 | 492 | 4.0E-06 |
| sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 29 | 510 | 4.0E-06 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 310 | 482 | 4.0E-06 |
| sp|Q5RBQ1|CP1A2_PONAB | Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 | 357 | 492 | 4.0E-06 |
| sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 280 | 481 | 6.0E-06 |
| sp|O44220|C12B1_DROAC | Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 | 307 | 508 | 6.0E-06 |
| sp|P9WPM5|CP137_MYCTU | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 | 254 | 508 | 7.0E-06 |
| sp|P9WPM4|CP137_MYCTO | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 | 254 | 508 | 7.0E-06 |
| sp|P00187|CP1A2_RABIT | Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 | 33 | 492 | 7.0E-06 |
| sp|Q9FF18|C7351_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 | 356 | 481 | 8.0E-06 |
| sp|P24453|CP1A2_MESAU | Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 | 312 | 504 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0004497 | monooxygenase activity | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0003674 | molecular_function | No |
| GO:0016491 | oxidoreductase activity | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0043169 | cation binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0046906 | tetrapyrrole binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 25 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 12 | 30 | 18 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|3136 MKWESLNKRETVFALAFGIGIVLAYQFYRASKLQSIPGPFIAKFTNLHRFFLTRSGYAHLYQARAHEKYGAVVRF GPNMVSFCDPEAIPSIFHMRNGFAKSNMYRAFRPWTPNGQIASVFSAEDDAENRQMKQHVAVYYSLSYTVSSFEK RVDDAIHMLFDQLNGKFVATGAQFNLTMWLKFYSYDIMALMTFRRAYGYLQHGDEFSTIMRDVKKSMMSIAPMTQ IPWLDWLLHKNRLVNSVKREAMSALLTFVLARIAERRNSSETASKTNVTGPDADGDFLGYFLQAMDKKADKVPLR YLTMWTMANILGGSDSSAAVLRSLVCLLAKHPNALETVRTELWNQQQTTTGLSLPVPQWHELQNLLFLDACINET LRTEPPFGLALERVVPVHGTTICGRFFPQGTIVGMNPYVTNRHRPTWGDDADVWRPRRWLEGNSAHIRKLEASLL TFGAGTRTCLGRQVAMLEIKKLLAALIINYDIGLVEPRAKVDRYFWIMMPESVQVTIRKRDKPRI* |
| Coding | >OphauG2|3136 ATGAAGTGGGAATCTCTAAACAAGAGAGAAACAGTCTTTGCACTGGCTTTTGGAATTGGCATAGTGCTGGCCTAT CAGTTCTACCGCGCGTCCAAGCTTCAGTCGATTCCTGGGCCGTTCATTGCCAAGTTTACCAATCTCCATCGCTTT TTCCTCACACGCAGTGGTTACGCTCACCTGTATCAAGCCCGCGCTCACGAGAAATATGGCGCCGTTGTGCGGTTT GGTCCCAACATGGTGTCGTTTTGCGACCCAGAGGCCATTCCGTCAATCTTTCACATGCGAAACGGGTTTGCCAAG AGCAACATGTATCGCGCCTTTCGGCCATGGACCCCGAATGGCCAGATTGCCTCCGTCTTTAGTGCAGAAGACGAT GCAGAAAATCGACAAATGAAGCAACACGTGGCCGTGTACTATTCGCTCTCTTACACCGTGTCTTCATTCGAGAAA CGAGTCGATGACGCTATCCACATGCTCTTTGACCAGCTGAATGGCAAATTCGTCGCTACGGGAGCCCAATTCAAC CTTACAATGTGGTTGAAATTTTACTCGTACGACATTATGGCGTTGATGACATTTCGCCGCGCATACGGATACCTC CAACATGGGGATGAATTTTCCACCATTATGCGAGATGTCAAAAAGTCCATGATGAGTATTGCACCGATGACGCAG ATTCCGTGGCTCGATTGGCTTTTGCACAAGAATCGACTCGTAAACTCGGTTAAGCGCGAGGCCATGTCTGCTCTC CTGACCTTTGTTCTCGCGCGCATCGCAGAGCGCCGAAACAGTTCCGAGACAGCCTCCAAGACAAATGTAACCGGC CCCGACGCCGACGGCGACTTTCTCGGCTATTTCCTGCAAGCCATGGACAAGAAAGCAGACAAGGTGCCGCTTCGA TATCTGACAATGTGGACCATGGCCAATATTCTGGGAGGATCCGACTCTTCGGCTGCTGTGCTTCGCTCGTTAGTG TGTCTCCTGGCTAAACACCCTAACGCCTTGGAAACCGTGCGGACAGAACTTTGGAATCAGCAGCAGACTACTACC GGACTCTCTCTTCCGGTTCCTCAATGGCACGAGCTGCAGAACCTCCTATTCCTGGATGCTTGTATTAACGAGACG CTTCGTACGGAACCTCCCTTTGGCCTCGCTCTCGAAAGAGTGGTACCTGTACACGGAACGACAATCTGTGGCCGA TTTTTCCCCCAAGGGACCATTGTTGGCATGAATCCCTATGTTACCAATCGCCACCGGCCCACGTGGGGGGATGAT GCTGATGTGTGGCGTCCGCGTCGCTGGTTGGAGGGAAACTCGGCACATATCAGAAAGCTTGAGGCTAGTTTGCTG ACGTTTGGGGCGGGCACGAGAACTTGCCTGGGCCGCCAAGTCGCCATGCTCGAAATCAAGAAGCTGCTGGCAGCT CTCATCATCAACTATGATATTGGCCTCGTCGAACCCCGAGCAAAGGTCGACCGGTACTTTTGGATCATGATGCCG GAGAGTGTACAGGTGACTATTAGAAAACGAGACAAGCCCAGGATTTAA |
| Transcript | >OphauG2|3136 ATGAAGTGGGAATCTCTAAACAAGAGAGAAACAGTCTTTGCACTGGCTTTTGGAATTGGCATAGTGCTGGCCTAT CAGTTCTACCGCGCGTCCAAGCTTCAGTCGATTCCTGGGCCGTTCATTGCCAAGTTTACCAATCTCCATCGCTTT TTCCTCACACGCAGTGGTTACGCTCACCTGTATCAAGCCCGCGCTCACGAGAAATATGGCGCCGTTGTGCGGTTT GGTCCCAACATGGTGTCGTTTTGCGACCCAGAGGCCATTCCGTCAATCTTTCACATGCGAAACGGGTTTGCCAAG AGCAACATGTATCGCGCCTTTCGGCCATGGACCCCGAATGGCCAGATTGCCTCCGTCTTTAGTGCAGAAGACGAT GCAGAAAATCGACAAATGAAGCAACACGTGGCCGTGTACTATTCGCTCTCTTACACCGTGTCTTCATTCGAGAAA CGAGTCGATGACGCTATCCACATGCTCTTTGACCAGCTGAATGGCAAATTCGTCGCTACGGGAGCCCAATTCAAC CTTACAATGTGGTTGAAATTTTACTCGTACGACATTATGGCGTTGATGACATTTCGCCGCGCATACGGATACCTC CAACATGGGGATGAATTTTCCACCATTATGCGAGATGTCAAAAAGTCCATGATGAGTATTGCACCGATGACGCAG ATTCCGTGGCTCGATTGGCTTTTGCACAAGAATCGACTCGTAAACTCGGTTAAGCGCGAGGCCATGTCTGCTCTC CTGACCTTTGTTCTCGCGCGCATCGCAGAGCGCCGAAACAGTTCCGAGACAGCCTCCAAGACAAATGTAACCGGC CCCGACGCCGACGGCGACTTTCTCGGCTATTTCCTGCAAGCCATGGACAAGAAAGCAGACAAGGTGCCGCTTCGA TATCTGACAATGTGGACCATGGCCAATATTCTGGGAGGATCCGACTCTTCGGCTGCTGTGCTTCGCTCGTTAGTG TGTCTCCTGGCTAAACACCCTAACGCCTTGGAAACCGTGCGGACAGAACTTTGGAATCAGCAGCAGACTACTACC GGACTCTCTCTTCCGGTTCCTCAATGGCACGAGCTGCAGAACCTCCTATTCCTGGATGCTTGTATTAACGAGACG CTTCGTACGGAACCTCCCTTTGGCCTCGCTCTCGAAAGAGTGGTACCTGTACACGGAACGACAATCTGTGGCCGA TTTTTCCCCCAAGGGACCATTGTTGGCATGAATCCCTATGTTACCAATCGCCACCGGCCCACGTGGGGGGATGAT GCTGATGTGTGGCGTCCGCGTCGCTGGTTGGAGGGAAACTCGGCACATATCAGAAAGCTTGAGGCTAGTTTGCTG ACGTTTGGGGCGGGCACGAGAACTTGCCTGGGCCGCCAAGTCGCCATGCTCGAAATCAAGAAGCTGCTGGCAGCT CTCATCATCAACTATGATATTGGCCTCGTCGAACCCCGAGCAAAGGTCGACCGGTACTTTTGGATCATGATGCCG GAGAGTGTACAGGTGACTATTAGAAAACGAGACAAGCCCAGGATTTAA |
| Gene | >OphauG2|3136 ATGAAGTGGGAATCTCTAAACAAGAGAGAAACAGTCTTTGCACTGGCTTTTGGAATTGGCATAGTGCTGGCCTAT CAGTTCTACCGCGCGTCCAAGCTTCAGTCGATTCCTGGGCCGTTCATTGCCAAGTTTACCAATCTCCATCGCTTT TTCCTCACACGCAGTGGTTACGCTCACCTGTATCAAGCCCGCGCTCACGAGAAATATGGCGCCGTTGTGCGGTTT GGTCCCAACATGGTGTCGTTTTGCGACCCAGAGGCCATTCCGTCAATCTTTCACATGCGAAACGGGTTTGCCAAG GCATTCCAACCTCTGTCTCTCTCGCTCTATCGTGAAGTACGTCTAACAAGAAGCAGAGCAACATGTATCGCGCCT TTCGGCCATGGACCCCGAATGGCCAGATTGCCTCCGTCTTTAGTGCAGAAGACGATGCAGAAAATCGACAAATGA AGCAACACGTGGCCGTGTACTATTCGCTCTCTTACACCGTGTCTTCATTCGAGAAACGAGTCGATGACGCTATCC ACATGCTCTTTGACCAGCTGAATGGCAAATTCGTCGCTACGGGAGCCCAATTCAACCTTACAATGTGGTTGAAAT TTTACTCGTACGACATTATGGCGTTGATGACATTTCGCCGCGCATACGGATACCTCCAACATGGGGATGAATTTT CCACCATTATGCGAGATGTCAAAAAGTCCATGATGAGTATTGCACCGGTCAGTTGTCGGTGCAGGTGCAGATATA TATTTGGAGAAGCGCTAAAGGATTGTAGATGACGCAGATTCCGTGGCTCGATTGGCTTTTGCACAAGAATCGACT CGTAAACTCGGTTAAGCGCGAGGCCATGTCTGCTCTCCTGACCTTTGTTCTCGCGCGCATCGCAGAGCGCCGAAA CAGTTCCGAGACAGCCTCCAAGACAAATGTAACCGGCCCCGACGCCGACGGCGACTTTCTCGGCTATTTCCTGCA AGCCATGGACAAGAAAGCAGACAAGGTGCCGCTTCGATATCTGACAATGTGGACCATGGCCAATATTCTGGGAGG ATCCGACTCTTCGGCTGCTGTGCTTCGCTCGTTAGTGTGTCTCCTGGCTAAACACCCTAACGCCTTGGAAACCGT GCGGACAGAACTTTGGAATCAGCAGCAGACTACTACCGGACTCTCTCTTCCGGTTCCTCAATGGCACGAGCTGCA GAACCTCCTATTCCTGGATGCTTGTATTAACGAGACGCTTCGTACGGAACCTCCCTTTGGCCTCGCTCTCGAAAG AGTGGTACCTGTACACGGAACGACAATCTGTGGCCGATTTTTCCCCCAAGGGACCATTGTTGGCATGAATCCCTA TGTTACCAATCGCCACCGGCCCACGTGGGGGGATGATGCTGATGTGTGGCGTCCGCGTCGCTGGTTGGAGGGAAA CTCGGCACATATCAGAAAGCTTGAGGCTAGTTTGCTGACGGTACGTCCAACCAAGCCCAGTCCATTGATACATTC AACGTCTGATAAGGCCAGTTTGGGGCGGGCACGAGAACTTGCCTGGGCCGCCAAGTCGCCATGCTCGAAATCAAG AAGCTGCTGGCAGCTCTCATCATCAACTATGATGTGAGTGCGCATCACGCCCTTGATGAAATTAGCTCATGTTTC TAGATTGGCCTCGTCGAACCCCGAGCAAAGGTCGACCGGTACTTTTGGATCATGATGCCGGAGAGTGTACAGGTG ACTATTAGAAAACGAGACAAGCCCAGGATTTAA |