Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3135
Gene name
LocationContig_23:49808..50750
Strand-
Gene length (bp)942
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 2.2E-14 99 221
PF08242 Methyltransf_12 Methyltransferase domain 1.0E-08 102 213
PF08241 Methyltransf_11 Methyltransferase domain 1.1E-08 102 215
PF13649 Methyltransf_25 Methyltransferase domain 3.3E-08 101 211
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.4E-04 100 222

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q562C4|MET7B_RAT Methyltransferase-like protein 7B OS=Rattus norvegicus GN=Mettl7b PE=1 SV=1 100 288 1.0E-14
sp|Q9H8H3|MET7A_HUMAN Methyltransferase-like protein 7A OS=Homo sapiens GN=METTL7A PE=1 SV=1 100 288 4.0E-13
sp|Q9DD20|MET7B_MOUSE Methyltransferase-like protein 7B OS=Mus musculus GN=Mettl7b PE=1 SV=2 99 288 2.0E-12
sp|Q6UX53|MET7B_HUMAN Methyltransferase-like protein 7B OS=Homo sapiens GN=METTL7B PE=1 SV=2 100 288 7.0E-11

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3135
MAALLYTLKDLFLHLLEPWRFLVISLLHIPETVAAIIRDGEQHKLLSQSAFSEVLFAHFWATFGSQIRANSEASV
IPLLEGCVQNGHVCADAVHSPLYGTVLEIGAGCGTWVDVFARVRDNHPECPITKVYGVEPNLKSAALLTRRVEEL
GMNDVYQVAPVGIEALEASDSWHDSVPSGSVDCIVSILCMCSIPDPDENMRRLYRLLKPGGTLYVYEHVKATRGS
PIITLYQRLLNIPWPFFLGSCSLCRSTEKSLRAAGPWSKVDLAQPSEQPPYQVIPHLIGTLTK*
Coding >OphauG2|3135
ATGGCTGCTTTGCTTTACACGCTCAAGGACCTTTTCCTCCACCTCTTGGAGCCGTGGCGCTTCCTGGTTATATCG
CTGCTTCATATTCCGGAAACCGTCGCCGCAATCATACGCGATGGCGAGCAGCATAAGCTTCTATCTCAATCCGCC
TTTTCAGAGGTCCTCTTTGCTCATTTCTGGGCCACCTTTGGATCCCAAATCCGCGCCAACTCTGAGGCGAGCGTC
ATACCGCTGCTTGAAGGCTGCGTTCAGAATGGGCACGTCTGCGCCGATGCCGTTCATTCTCCTCTCTACGGCACC
GTGCTCGAAATCGGCGCAGGCTGCGGCACATGGGTCGATGTCTTTGCACGCGTCCGTGACAACCATCCAGAATGT
CCCATCACCAAGGTTTATGGTGTCGAGCCGAATCTAAAATCGGCTGCTTTGTTGACCCGCCGCGTCGAGGAGCTT
GGCATGAATGATGTTTACCAAGTCGCACCCGTTGGCATCGAGGCGCTCGAGGCCTCTGACTCTTGGCACGACAGC
GTCCCGTCTGGTTCTGTCGACTGCATCGTCAGTATCCTCTGCATGTGCAGTATCCCGGATCCCGACGAGAATATG
CGCCGCCTCTACCGTCTTCTCAAACCCGGAGGCACCTTGTACGTCTATGAGCATGTCAAGGCCACCAGAGGGTCC
CCGATCATCACCCTTTACCAACGTCTTTTGAACATTCCCTGGCCTTTTTTCCTGGGCTCGTGCAGCCTTTGTCGT
TCTACCGAAAAGAGCCTTCGGGCGGCCGGTCCGTGGTCAAAGGTGGACCTTGCCCAGCCGTCAGAGCAGCCGCCA
TACCAGGTTATACCTCATCTTATCGGAACCTTGACTAAGTAG
Transcript >OphauG2|3135
ATGGCTGCTTTGCTTTACACGCTCAAGGACCTTTTCCTCCACCTCTTGGAGCCGTGGCGCTTCCTGGTTATATCG
CTGCTTCATATTCCGGAAACCGTCGCCGCAATCATACGCGATGGCGAGCAGCATAAGCTTCTATCTCAATCCGCC
TTTTCAGAGGTCCTCTTTGCTCATTTCTGGGCCACCTTTGGATCCCAAATCCGCGCCAACTCTGAGGCGAGCGTC
ATACCGCTGCTTGAAGGCTGCGTTCAGAATGGGCACGTCTGCGCCGATGCCGTTCATTCTCCTCTCTACGGCACC
GTGCTCGAAATCGGCGCAGGCTGCGGCACATGGGTCGATGTCTTTGCACGCGTCCGTGACAACCATCCAGAATGT
CCCATCACCAAGGTTTATGGTGTCGAGCCGAATCTAAAATCGGCTGCTTTGTTGACCCGCCGCGTCGAGGAGCTT
GGCATGAATGATGTTTACCAAGTCGCACCCGTTGGCATCGAGGCGCTCGAGGCCTCTGACTCTTGGCACGACAGC
GTCCCGTCTGGTTCTGTCGACTGCATCGTCAGTATCCTCTGCATGTGCAGTATCCCGGATCCCGACGAGAATATG
CGCCGCCTCTACCGTCTTCTCAAACCCGGAGGCACCTTGTACGTCTATGAGCATGTCAAGGCCACCAGAGGGTCC
CCGATCATCACCCTTTACCAACGTCTTTTGAACATTCCCTGGCCTTTTTTCCTGGGCTCGTGCAGCCTTTGTCGT
TCTACCGAAAAGAGCCTTCGGGCGGCCGGTCCGTGGTCAAAGGTGGACCTTGCCCAGCCGTCAGAGCAGCCGCCA
TACCAGGTTATACCTCATCTTATCGGAACCTTGACTAAGTAG
Gene >OphauG2|3135
ATGGCTGCTTTGCTTTACACGCTCAAGGACCTTTTCCTCCACCTCTTGGAGCCGTGGCGCTTCCTGGTTATATCG
CTGCTTCATATTCCGGAAACCGTCGCCGCAATCATACGCGATGGCGAGCAGCATAAGCTTCTATCTCAATCCGCC
TTTTCAGAGGTCCTCTTTGCTCATTTCTGGGCCACCTTTGGATCCCAAATCCGCGCCAACTCTGAGGCGAGCGTC
ATACCGCTGCTTGAAGGCTGCGTTCAGAATGGGCACGTCTGCGCCGATGCCGTTCATTCTCCTCTCTACGGCACC
GTGCTCGAAATCGGCGCAGGCTGCGGCACATGGGTCGATGTCTTTGCACGCGTCCGTGACAACCATCCAGAATGT
CCCATCACCAAGGTTTATGGTGTCGAGCCGAATCTAAAATCGGCTGCTTTGTTGACCCGCCGCGTCGAGGAGCTT
GGCATGAATGATGTTTACCAAGTCGCACCCGTTGGCATCGAGGCGCTCGAGGCCTCTGACTCTTGGCACGACAGC
GTCCCGTCTGGTTCTGTCGACTGCATCGTCAGTATCCTCTGCATGTGCAGTATCCCGGATCCCGACGAGAATATG
CGCCGCCTCTACCGTCTTCTCAAACCCGGAGGCACCTTGTACGTCTATGAGCATGTCAAGGCCACCAGAGGGTCC
CCGATCATCACCCTTTACCAACGTGAGTATACCTCCTCTTCTCTTCGTCTGCCAAACACCTTTCCCACTCTCTTA
CCCGCCTTCTCTTTTGTTCTAGGTCTTTTGAACATTCCCTGGCCTTTTTTCCTGGGCTCGTGCAGCCTTTGTCGT
TCTACCGAAAAGAGCCTTCGGGCGGCCGGTCCGTGGTCAAAGGTGGACCTTGCCCAGCCGTCAGAGCAGCCGCCA
TACCAGGTTATACCTCATCTTATCGGAACCTTGACTAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail