Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3116
Gene name
LocationContig_229:20157..21852
Strand-
Gene length (bp)1695
Transcript length (bp)1695
Coding sequence length (bp)1695
Protein length (aa) 565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.7E-13 356 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74452|SCW1_SCHPO Cell wall integrity protein scw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scw1 PE=1 SV=1 81 436 6.0E-39
sp|P34761|WHI3_YEAST Protein WHI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WHI3 PE=1 SV=1 342 436 1.0E-36
sp|Q07655|WHI4_YEAST Protein WHI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WHI4 PE=1 SV=1 342 436 2.0E-34
sp|O59784|MDE7_SCHPO RNA-binding protein mde7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde7 PE=3 SV=1 348 439 4.0E-29
sp|Q8H0P8|RBP1_MEDTR RNA-binding protein 1 OS=Medicago truncatula GN=RBP1 PE=2 SV=1 325 438 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74452|SCW1_SCHPO Cell wall integrity protein scw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scw1 PE=1 SV=1 81 436 6.0E-39
sp|P34761|WHI3_YEAST Protein WHI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WHI3 PE=1 SV=1 342 436 1.0E-36
sp|Q07655|WHI4_YEAST Protein WHI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WHI4 PE=1 SV=1 342 436 2.0E-34
sp|O59784|MDE7_SCHPO RNA-binding protein mde7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde7 PE=3 SV=1 348 439 4.0E-29
sp|Q8H0P8|RBP1_MEDTR RNA-binding protein 1 OS=Medicago truncatula GN=RBP1 PE=2 SV=1 325 438 3.0E-06
sp|A1A6K6|NSRA_ARATH Nuclear speckle RNA-binding protein A OS=Arabidopsis thaliana GN=NSRA PE=2 SV=1 354 441 8.0E-06
sp|G7ID19|RBP2_MEDTR RNA-binding protein 2 OS=Medicago truncatula GN=RBP2 PE=2 SV=1 354 444 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3116
MYQRAHPQPPPPLTTNSPWPSLGAASRLFARDTNSSAPPPPTAPRDPSPTPPCDPSPTPPRAPSVFSDPSILYQP
DAVVFLRLRNLPSSASEENVHLLLAWAQGLTSIRILPDDRGKNSCASALLTFRSRKEACTAKQVLDQYTHSFTAH
FLIDILDYAYHAGENMAPSPPVSRQSASHRNLPPLRFPNGALSSADNISPTSTTAAFSHQGRTASYHNIYSPQSP
MGTQPPENTRMSGKSLISRDFGDDETTDLIRDPVAYAENGPVSQRRATAPQIPTLRMGSLSLATTSHAPSASSPP
CPSSLPQYGFMPSNSAFGVSSGHAAQGLMYGHHFQPRHNNFPPVNPADQNPPCNTLYVGNLPIDTSEEELKAIFS
KQRGYKRLCFRTKQNGPMCFVEFEDVAFATRALTEMYGHLLHNSVKGGIRLSFSKNPLGVRSGQPGSHGVTGPMG
PMAPHPAAFTTVQGPPPGLAAPPGLGAARSNSFNWGSHLSNGAMSNGAMSNGGMSMSNGGMSNGGSSSRHNNMPI
LPGSARHPQAMGTPMPMNGPSLQTAYGGCANMPRNMVGR*
Coding >OphauG2|3116
ATGTATCAGCGGGCTCACCCTCAACCGCCGCCCCCCCTCACCACAAACTCGCCATGGCCCTCGCTAGGCGCCGCT
TCTCGTCTCTTCGCTCGCGACACCAACTCGTCGGCCCCGCCTCCTCCCACGGCTCCCCGCGACCCTTCTCCCACG
CCTCCCTGCGACCCTTCTCCCACGCCTCCCCGCGCCCCTTCAGTCTTCTCGGACCCGTCAATCTTGTACCAGCCT
GACGCTGTTGTCTTCCTCCGCCTCCGCAACCTGCCCAGCAGTGCTTCCGAAGAAAATGTCCACCTGCTGCTCGCT
TGGGCCCAAGGCCTCACCTCTATCCGCATCCTACCCGACGACCGCGGCAAGAATTCTTGTGCCTCTGCTCTGCTC
ACCTTCCGCTCCCGCAAAGAAGCCTGCACTGCCAAGCAAGTCCTCGACCAGTACACCCACTCCTTTACCGCCCAC
TTCCTTATCGACATTCTGGACTATGCATACCACGCCGGGGAAAACATGGCCCCATCTCCCCCCGTCTCACGACAG
TCAGCCTCTCATCGTAACCTGCCGCCCCTGCGCTTTCCAAATGGTGCCCTTTCATCTGCCGACAACATCTCGCCA
ACCTCAACCACGGCTGCCTTTTCCCATCAAGGTCGGACTGCCTCGTACCACAATATTTACTCTCCTCAGTCACCC
ATGGGTACTCAGCCACCGGAAAACACGAGAATGTCTGGCAAGTCACTGATTAGTCGGGACTTTGGCGATGACGAG
ACGACGGATCTTATCCGAGATCCTGTGGCATATGCCGAAAATGGCCCCGTTTCCCAGAGGCGAGCTACCGCGCCG
CAAATCCCCACGTTGCGAATGGGCAGTCTCTCCCTGGCCACCACTAGCCATGCACCCTCTGCCAGTAGCCCGCCC
TGCCCGTCATCTCTCCCCCAGTATGGTTTCATGCCGTCCAACTCGGCATTCGGAGTCTCATCGGGCCATGCTGCA
CAAGGCCTCATGTACGGTCATCACTTTCAGCCGCGGCACAATAACTTCCCCCCGGTCAATCCGGCGGACCAGAAC
CCGCCCTGCAACACCCTCTATGTCGGCAACCTTCCCATTGACACGTCTGAAGAGGAGCTCAAGGCCATCTTCTCC
AAACAGCGAGGCTACAAGCGGCTCTGTTTCCGTACCAAGCAAAACGGTCCCATGTGCTTTGTCGAGTTTGAGGAT
GTAGCCTTTGCCACAAGGGCTCTCACCGAGATGTACGGCCATCTACTTCACAATAGTGTCAAGGGGGGTATTCGC
CTCAGTTTCTCCAAGAACCCGCTGGGCGTGCGTTCTGGTCAACCCGGTTCTCATGGCGTTACGGGCCCAATGGGG
CCCATGGCACCACATCCCGCTGCATTCACCACTGTCCAGGGCCCGCCTCCCGGCCTGGCCGCTCCTCCTGGTCTA
GGCGCCGCTCGTTCCAACAGTTTCAATTGGGGCTCGCATTTGAGCAACGGCGCAATGAGCAATGGCGCAATGAGC
AATGGCGGCATGAGCATGAGCAATGGCGGCATGAGCAATGGCGGCAGTAGCTCGCGTCACAACAATATGCCCATT
CTTCCGGGCTCTGCGCGCCATCCTCAAGCCATGGGCACCCCCATGCCCATGAACGGTCCGAGTTTGCAGACTGCC
TATGGGGGCTGTGCAAATATGCCACGCAACATGGTGGGCAGATGA
Transcript >OphauG2|3116
ATGTATCAGCGGGCTCACCCTCAACCGCCGCCCCCCCTCACCACAAACTCGCCATGGCCCTCGCTAGGCGCCGCT
TCTCGTCTCTTCGCTCGCGACACCAACTCGTCGGCCCCGCCTCCTCCCACGGCTCCCCGCGACCCTTCTCCCACG
CCTCCCTGCGACCCTTCTCCCACGCCTCCCCGCGCCCCTTCAGTCTTCTCGGACCCGTCAATCTTGTACCAGCCT
GACGCTGTTGTCTTCCTCCGCCTCCGCAACCTGCCCAGCAGTGCTTCCGAAGAAAATGTCCACCTGCTGCTCGCT
TGGGCCCAAGGCCTCACCTCTATCCGCATCCTACCCGACGACCGCGGCAAGAATTCTTGTGCCTCTGCTCTGCTC
ACCTTCCGCTCCCGCAAAGAAGCCTGCACTGCCAAGCAAGTCCTCGACCAGTACACCCACTCCTTTACCGCCCAC
TTCCTTATCGACATTCTGGACTATGCATACCACGCCGGGGAAAACATGGCCCCATCTCCCCCCGTCTCACGACAG
TCAGCCTCTCATCGTAACCTGCCGCCCCTGCGCTTTCCAAATGGTGCCCTTTCATCTGCCGACAACATCTCGCCA
ACCTCAACCACGGCTGCCTTTTCCCATCAAGGTCGGACTGCCTCGTACCACAATATTTACTCTCCTCAGTCACCC
ATGGGTACTCAGCCACCGGAAAACACGAGAATGTCTGGCAAGTCACTGATTAGTCGGGACTTTGGCGATGACGAG
ACGACGGATCTTATCCGAGATCCTGTGGCATATGCCGAAAATGGCCCCGTTTCCCAGAGGCGAGCTACCGCGCCG
CAAATCCCCACGTTGCGAATGGGCAGTCTCTCCCTGGCCACCACTAGCCATGCACCCTCTGCCAGTAGCCCGCCC
TGCCCGTCATCTCTCCCCCAGTATGGTTTCATGCCGTCCAACTCGGCATTCGGAGTCTCATCGGGCCATGCTGCA
CAAGGCCTCATGTACGGTCATCACTTTCAGCCGCGGCACAATAACTTCCCCCCGGTCAATCCGGCGGACCAGAAC
CCGCCCTGCAACACCCTCTATGTCGGCAACCTTCCCATTGACACGTCTGAAGAGGAGCTCAAGGCCATCTTCTCC
AAACAGCGAGGCTACAAGCGGCTCTGTTTCCGTACCAAGCAAAACGGTCCCATGTGCTTTGTCGAGTTTGAGGAT
GTAGCCTTTGCCACAAGGGCTCTCACCGAGATGTACGGCCATCTACTTCACAATAGTGTCAAGGGGGGTATTCGC
CTCAGTTTCTCCAAGAACCCGCTGGGCGTGCGTTCTGGTCAACCCGGTTCTCATGGCGTTACGGGCCCAATGGGG
CCCATGGCACCACATCCCGCTGCATTCACCACTGTCCAGGGCCCGCCTCCCGGCCTGGCCGCTCCTCCTGGTCTA
GGCGCCGCTCGTTCCAACAGTTTCAATTGGGGCTCGCATTTGAGCAACGGCGCAATGAGCAATGGCGCAATGAGC
AATGGCGGCATGAGCATGAGCAATGGCGGCATGAGCAATGGCGGCAGTAGCTCGCGTCACAACAATATGCCCATT
CTTCCGGGCTCTGCGCGCCATCCTCAAGCCATGGGCACCCCCATGCCCATGAACGGTCCGAGTTTGCAGACTGCC
TATGGGGGCTGTGCAAATATGCCACGCAACATGGTGGGCAGATGA
Gene >OphauG2|3116
ATGTATCAGCGGGCTCACCCTCAACCGCCGCCCCCCCTCACCACAAACTCGCCATGGCCCTCGCTAGGCGCCGCT
TCTCGTCTCTTCGCTCGCGACACCAACTCGTCGGCCCCGCCTCCTCCCACGGCTCCCCGCGACCCTTCTCCCACG
CCTCCCTGCGACCCTTCTCCCACGCCTCCCCGCGCCCCTTCAGTCTTCTCGGACCCGTCAATCTTGTACCAGCCT
GACGCTGTTGTCTTCCTCCGCCTCCGCAACCTGCCCAGCAGTGCTTCCGAAGAAAATGTCCACCTGCTGCTCGCT
TGGGCCCAAGGCCTCACCTCTATCCGCATCCTACCCGACGACCGCGGCAAGAATTCTTGTGCCTCTGCTCTGCTC
ACCTTCCGCTCCCGCAAAGAAGCCTGCACTGCCAAGCAAGTCCTCGACCAGTACACCCACTCCTTTACCGCCCAC
TTCCTTATCGACATTCTGGACTATGCATACCACGCCGGGGAAAACATGGCCCCATCTCCCCCCGTCTCACGACAG
TCAGCCTCTCATCGTAACCTGCCGCCCCTGCGCTTTCCAAATGGTGCCCTTTCATCTGCCGACAACATCTCGCCA
ACCTCAACCACGGCTGCCTTTTCCCATCAAGGTCGGACTGCCTCGTACCACAATATTTACTCTCCTCAGTCACCC
ATGGGTACTCAGCCACCGGAAAACACGAGAATGTCTGGCAAGTCACTGATTAGTCGGGACTTTGGCGATGACGAG
ACGACGGATCTTATCCGAGATCCTGTGGCATATGCCGAAAATGGCCCCGTTTCCCAGAGGCGAGCTACCGCGCCG
CAAATCCCCACGTTGCGAATGGGCAGTCTCTCCCTGGCCACCACTAGCCATGCACCCTCTGCCAGTAGCCCGCCC
TGCCCGTCATCTCTCCCCCAGTATGGTTTCATGCCGTCCAACTCGGCATTCGGAGTCTCATCGGGCCATGCTGCA
CAAGGCCTCATGTACGGTCATCACTTTCAGCCGCGGCACAATAACTTCCCCCCGGTCAATCCGGCGGACCAGAAC
CCGCCCTGCAACACCCTCTATGTCGGCAACCTTCCCATTGACACGTCTGAAGAGGAGCTCAAGGCCATCTTCTCC
AAACAGCGAGGCTACAAGCGGCTCTGTTTCCGTACCAAGCAAAACGGTCCCATGTGCTTTGTCGAGTTTGAGGAT
GTAGCCTTTGCCACAAGGGCTCTCACCGAGATGTACGGCCATCTACTTCACAATAGTGTCAAGGGGGGTATTCGC
CTCAGTTTCTCCAAGAACCCGCTGGGCGTGCGTTCTGGTCAACCCGGTTCTCATGGCGTTACGGGCCCAATGGGG
CCCATGGCACCACATCCCGCTGCATTCACCACTGTCCAGGGCCCGCCTCCCGGCCTGGCCGCTCCTCCTGGTCTA
GGCGCCGCTCGTTCCAACAGTTTCAATTGGGGCTCGCATTTGAGCAACGGCGCAATGAGCAATGGCGCAATGAGC
AATGGCGGCATGAGCATGAGCAATGGCGGCATGAGCAATGGCGGCAGTAGCTCGCGTCACAACAATATGCCCATT
CTTCCGGGCTCTGCGCGCCATCCTCAAGCCATGGGCACCCCCATGCCCATGAACGGTCCGAGTTTGCAGACTGCC
TATGGGGGCTGTGCAAATATGCCACGCAACATGGTGGGCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail