Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3108
Gene name
LocationContig_2288:78..498
Strand+
Gene length (bp)420
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08623 TIP120 TATA-binding protein interacting (TIP20) 1.2E-36 1 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BAH2|CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=candA-C PE=1 SV=1 1 127 8.0E-24
sp|Q5R6L5|CAND1_PONAB Cullin-associated NEDD8-dissociated protein 1 OS=Pongo abelii GN=CAND1 PE=2 SV=1 1 91 4.0E-11
sp|P97536|CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus GN=Cand1 PE=1 SV=1 1 91 4.0E-11
sp|Q6ZQ38|CAND1_MOUSE Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus GN=Cand1 PE=1 SV=2 1 91 4.0E-11
sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens GN=CAND1 PE=1 SV=2 1 91 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BAH2|CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=candA-C PE=1 SV=1 1 127 8.0E-24
sp|Q5R6L5|CAND1_PONAB Cullin-associated NEDD8-dissociated protein 1 OS=Pongo abelii GN=CAND1 PE=2 SV=1 1 91 4.0E-11
sp|P97536|CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus GN=Cand1 PE=1 SV=1 1 91 4.0E-11
sp|Q6ZQ38|CAND1_MOUSE Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus GN=Cand1 PE=1 SV=2 1 91 4.0E-11
sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens GN=CAND1 PE=1 SV=2 1 91 4.0E-11
sp|A7MBJ5|CAND1_BOVIN Cullin-associated NEDD8-dissociated protein 1 OS=Bos taurus GN=CAND1 PE=2 SV=1 1 91 4.0E-11
sp|Q6ZQ73|CAND2_MOUSE Cullin-associated NEDD8-dissociated protein 2 OS=Mus musculus GN=Cand2 PE=1 SV=2 1 91 6.0E-10
sp|O75155|CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens GN=CAND2 PE=1 SV=3 1 91 2.0E-09
sp|Q9R0L4|CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus GN=Cand2 PE=1 SV=1 1 91 2.0E-09
sp|Q9VKY2|CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster GN=Cand1 PE=2 SV=1 1 93 3.0E-09
sp|G5ED41|CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans GN=cand-1 PE=1 SV=1 1 101 4.0E-07
sp|Q86KD1|CAND1_DICDI Cullin-associated NEDD8-dissociated protein 1 OS=Dictyostelium discoideum GN=cand1 PE=3 SV=1 1 86 9.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11566
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3108 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3108
MDTAFTRINNVELYDRVVAGLKDENDIRQLCNLMVMKLIVLDVAETARRLDTIAEAYRSVLSIKLKDNAVKQDVE
KQEEANKSVLRVTLLLGEKLKGMNDNGSTGAGTWASYWEWVNKDFDKQLKGLHQRSKELQTRMV*
Coding >OphauG2|3108
ATGGATACAGCATTTACACGCATCAACAATGTAGAGTTGTACGACCGCGTCGTTGCAGGACTTAAGGATGAAAAC
GATATTCGGCAGCTGTGCAATCTCATGGTGATGAAGCTCATTGTGCTGGATGTGGCGGAGACGGCACGGCGGCTC
GACACGATTGCCGAGGCGTATAGAAGCGTCTTGTCCATCAAGCTCAAGGATAATGCCGTTAAGCAGGATGTGGAG
AAGCAAGAAGAGGCCAACAAGAGCGTGCTAAGGGTGACTCTACTTTTGGGGGAAAAGCTAAAGGGCATGAATGAC
AATGGGAGCACGGGGGCGGGCACATGGGCATCGTACTGGGAATGGGTCAATAAGGACTTTGACAAGCAGCTCAAG
GGCTTGCACCAGAGGAGCAAGGAGCTGCAGACGCGCATGGTCTGA
Transcript >OphauG2|3108
ATGGATACAGCATTTACACGCATCAACAATGTAGAGTTGTACGACCGCGTCGTTGCAGGACTTAAGGATGAAAAC
GATATTCGGCAGCTGTGCAATCTCATGGTGATGAAGCTCATTGTGCTGGATGTGGCGGAGACGGCACGGCGGCTC
GACACGATTGCCGAGGCGTATAGAAGCGTCTTGTCCATCAAGCTCAAGGATAATGCCGTTAAGCAGGATGTGGAG
AAGCAAGAAGAGGCCAACAAGAGCGTGCTAAGGGTGACTCTACTTTTGGGGGAAAAGCTAAAGGGCATGAATGAC
AATGGGAGCACGGGGGCGGGCACATGGGCATCGTACTGGGAATGGGTCAATAAGGACTTTGACAAGCAGCTCAAG
GGCTTGCACCAGAGGAGCAAGGAGCTGCAGACGCGCATGGTCTGA
Gene >OphauG2|3108
ATGGATACAGCATTTACACGCATCAACAATGTAGAGTTGTACGACCGCGTCGTTGCAGGACTTAAGGATGAAAAC
GATATTCGGCAGCTGTGCAATCTCATGGTGATGAAGCTCATTGTGCTGGATGTGGCGGAGACGGCACGGCGGCTC
GACACGATTGCCGAGGCGTATAGAAGCGTCTTGTCCATCAAGCTCAAGGATAATGCCGTTAAGCAGGATGTGGAG
AAGCAAGAAGAGGCCAACAAGAGCGTGCTAAGGGTGACTCTACTTTTGGGGGAAAAGCTAAAGGGCATGAATGAC
AATGGGAGCACGGGGGCGGGCACATGGGCATCGTACTGGGAATGGGTCAATAAGGACTTTGACAAGCAGCTCAAG
GGCTTGCACCAGAGGAGCAAGGAGCTGCAGACGCGCATGGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail