Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3104
Gene name
LocationContig_228:17208..18474
Strand-
Gene length (bp)1266
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 1.5E-35 55 182
PF02984 Cyclin_C Cyclin, C-terminal domain 4.9E-06 189 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YH3|CG11_CANAL G1/S-specific cyclin CCN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCN1 PE=1 SV=1 51 223 1.0E-53
sp|P0CY18|CG11_CANAX G1/S-specific cyclin CLN1 OS=Candida albicans GN=CLN1 PE=3 SV=1 51 223 2.0E-53
sp|C4YR54|CG11_CANAW G1/S-specific cyclin CCN1 OS=Candida albicans (strain WO-1) GN=CCN1 PE=3 SV=1 51 223 2.0E-53
sp|Q5A1N6|CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLN3 PE=1 SV=1 51 203 6.0E-34
sp|P43062|CG12_CANAX G1/S-specific cyclin CLN2 OS=Candida albicans GN=CLN2 PE=3 SV=1 51 203 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YH3|CG11_CANAL G1/S-specific cyclin CCN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCN1 PE=1 SV=1 51 223 1.0E-53
sp|P0CY18|CG11_CANAX G1/S-specific cyclin CLN1 OS=Candida albicans GN=CLN1 PE=3 SV=1 51 223 2.0E-53
sp|C4YR54|CG11_CANAW G1/S-specific cyclin CCN1 OS=Candida albicans (strain WO-1) GN=CCN1 PE=3 SV=1 51 223 2.0E-53
sp|Q5A1N6|CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLN3 PE=1 SV=1 51 203 6.0E-34
sp|P43062|CG12_CANAX G1/S-specific cyclin CLN2 OS=Candida albicans GN=CLN2 PE=3 SV=1 51 203 2.0E-33
sp|P25009|PUC1_SCHPO Cyclin puc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puc1 PE=3 SV=1 25 186 3.0E-32
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 51 242 7.0E-29
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 49 243 1.0E-28
sp|Q5A0A9|CG24_CANAL G2/mitotic-specific cyclin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB4 PE=1 SV=1 51 251 3.0E-27
sp|Q39067|CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana GN=CYCB1-2 PE=1 SV=2 48 243 1.0E-26
sp|Q39069|CCB13_ARATH Cyclin-B1-3 OS=Arabidopsis thaliana GN=CYCB1-3 PE=2 SV=2 48 243 1.0E-26
sp|Q0DH40|CCB15_ORYSJ Cyclin-B1-5 OS=Oryza sativa subsp. japonica GN=CYCB1-5 PE=3 SV=1 48 243 4.0E-26
sp|P25011|CCNB1_SOYBN G2/mitotic-specific cyclin S13-6 OS=Glycine max PE=2 SV=1 38 243 6.0E-26
sp|P34800|CCN1_ANTMA G2/mitotic-specific cyclin-1 OS=Antirrhinum majus PE=2 SV=1 48 243 3.0E-25
sp|P36630|CG22_SCHPO G2/mitotic-specific cyclin cig2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig2 PE=1 SV=2 49 242 4.0E-25
sp|P24870|CG23_YEAST G2/mitotic-specific cyclin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB3 PE=1 SV=3 51 244 1.0E-24
sp|Q06374|CG1_COLGL Putative G1/S-specific cyclin OS=Colletotrichum gloeosporioides GN=CYC1 PE=2 SV=1 34 233 1.0E-24
sp|P34801|CCN2_ANTMA G2/mitotic-specific cyclin-2 OS=Antirrhinum majus PE=2 SV=1 48 217 2.0E-24
sp|Q01J96|CCB21_ORYSI Cyclin-B2-1 OS=Oryza sativa subsp. indica GN=CYCB2-1 PE=1 SV=1 48 251 5.0E-24
sp|Q7XSJ6|CCB21_ORYSJ Cyclin-B2-1 OS=Oryza sativa subsp. japonica GN=CYCB2-1 PE=1 SV=2 48 251 6.0E-24
sp|Q0JIF2|CCB11_ORYSJ Cyclin-B1-1 OS=Oryza sativa subsp. japonica GN=CYCB1-1 PE=2 SV=2 48 243 1.0E-23
sp|P25012|CCNB2_SOYBN G2/mitotic-specific cyclin S13-7 (Fragment) OS=Glycine max PE=2 SV=1 74 243 1.0E-23
sp|O48790|CCB14_ARATH Cyclin-B1-4 OS=Arabidopsis thaliana GN=CYCB1-4 PE=2 SV=1 48 243 1.0E-23
sp|P24871|CG24_YEAST G2/mitotic-specific cyclin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB4 PE=1 SV=2 51 244 3.0E-23
sp|Q0D9C7|CCB22_ORYSJ Cyclin-B2-2 OS=Oryza sativa subsp. japonica GN=CYCB2-2 PE=1 SV=1 48 283 6.0E-23
sp|A2YH60|CCB22_ORYSI Cyclin-B2-2 OS=Oryza sativa subsp. indica GN=CYCB2-2 PE=1 SV=2 48 283 6.0E-23
sp|P46278|CCNB2_MEDSV G2/mitotic-specific cyclin-2 OS=Medicago sativa subsp. varia PE=2 SV=1 48 240 7.0E-23
sp|P30278|CCNB2_MEDSA G2/mitotic-specific cyclin-2 (Fragment) OS=Medicago sativa PE=2 SV=1 48 237 1.0E-22
sp|P24861|CCNA_PATVU G2/mitotic-specific cyclin-A OS=Patella vulgata PE=2 SV=1 51 241 2.0E-22
sp|P30276|CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus GN=Ccnb2 PE=1 SV=2 47 309 9.0E-22
sp|O77689|CCNB2_BOVIN G2/mitotic-specific cyclin-B2 OS=Bos taurus GN=CCNB2 PE=2 SV=2 47 309 1.0E-21
sp|P46277|CCNB1_MEDSV G2/mitotic-specific cyclin-1 OS=Medicago sativa subsp. varia PE=2 SV=1 48 240 1.0E-21
sp|Q0DJR9|CCA14_ORYSJ Cyclin-A1-4 OS=Oryza sativa subsp. japonica GN=CYCA1-4 PE=2 SV=2 55 245 2.0E-21
sp|P37883|CCNB2_MESAU G2/mitotic-specific cyclin-B2 OS=Mesocricetus auratus GN=CCNB2 PE=2 SV=1 47 309 2.0E-21
sp|P32943|CGS6_YEAST S-phase entry cyclin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB6 PE=2 SV=2 23 247 3.0E-21
sp|Q9C6Y3|CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana GN=CYCA1-1 PE=1 SV=1 55 240 4.0E-21
sp|O95067|CCNB2_HUMAN G2/mitotic-specific cyclin-B2 OS=Homo sapiens GN=CCNB2 PE=1 SV=1 47 309 5.0E-21
sp|Q9DG96|CCNB2_ORYLU G2/mitotic-specific cyclin-B2 OS=Oryzias luzonensis GN=ccnb2 PE=2 SV=1 47 240 7.0E-21
sp|P30183|CCB11_ARATH Cyclin-B1-1 OS=Arabidopsis thaliana GN=CYCB1-1 PE=1 SV=2 48 232 8.0E-21
sp|P29332|CCNB2_CHICK G2/mitotic-specific cyclin-B2 OS=Gallus gallus GN=CCNB2 PE=2 SV=1 47 295 1.0E-20
sp|Q9SA32|CCB31_ARATH Putative cyclin-B3-1 OS=Arabidopsis thaliana GN=CYCB3-1 PE=3 SV=2 40 240 3.0E-20
sp|Q4R7A8|CCNB2_MACFA G2/mitotic-specific cyclin-B2 OS=Macaca fascicularis GN=CCNB2 PE=2 SV=1 47 309 5.0E-20
sp|Q9DGA4|CCNB1_ORYCU G2/mitotic-specific cyclin-B1 OS=Oryzias curvinotus GN=ccnb1 PE=2 SV=1 51 244 5.0E-20
sp|Q9IBG0|CCNB2_ORYLA G2/mitotic-specific cyclin-B2 OS=Oryzias latipes GN=ccnb2 PE=2 SV=1 47 240 6.0E-20
sp|Q9LDM4|CCB23_ARATH Cyclin-B2-3 OS=Arabidopsis thaliana GN=CYCB2-3 PE=2 SV=2 48 240 6.0E-20
sp|Q9DGA3|CCNB2_ORYCU G2/mitotic-specific cyclin-B2 OS=Oryzias curvinotus GN=ccnb2 PE=2 SV=1 47 240 8.0E-20
sp|P24869|CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB2 PE=1 SV=1 51 244 1.0E-19
sp|P15206|CCNB_MARGL G2/mitotic-specific cyclin-B OS=Marthasterias glacialis PE=2 SV=1 47 240 1.0E-19
sp|P13351|CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis GN=ccnb2 PE=1 SV=1 47 243 1.0E-19
sp|Q9DGA0|CCNB1_ORYJA G2/mitotic-specific cyclin-B1 OS=Oryzias javanicus GN=ccnb1 PE=2 SV=2 51 244 1.0E-19
sp|P51943|CCNA2_MOUSE Cyclin-A2 OS=Mus musculus GN=Ccna2 PE=1 SV=2 51 243 2.0E-19
sp|P30274|CCNA2_BOVIN Cyclin-A2 OS=Bos taurus GN=CCNA2 PE=1 SV=2 51 243 2.0E-19
sp|P04962|CCNA_SPISO G2/mitotic-specific cyclin-A OS=Spisula solidissima PE=2 SV=1 51 241 2.0E-19
sp|P07818|CCNB_ARBPU G2/mitotic-specific cyclin-B OS=Arbacia punctulata PE=2 SV=1 47 240 2.0E-19
sp|P13365|CG13_YEAST G1/S-specific cyclin CLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN3 PE=1 SV=2 48 182 2.0E-19
sp|P20248|CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens GN=CCNA2 PE=1 SV=2 51 249 2.0E-19
sp|P25010|CCNAL_DAUCA G2/mitotic-specific cyclin C13-1 (Fragment) OS=Daucus carota PE=2 SV=1 47 240 3.0E-19
sp|Q9IBG1|CCNB1_ORYLA G2/mitotic-specific cyclin-B1 OS=Oryzias latipes GN=ccnb1 PE=2 SV=1 51 244 3.0E-19
sp|Q9DG99|CCNB2_ORYJA G2/mitotic-specific cyclin-B2 OS=Oryzias javanicus GN=ccnb2 PE=2 SV=1 47 240 3.0E-19
sp|P24865|CG21_SCHPO G2/mitotic-specific cyclin cig1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig1 PE=1 SV=2 51 241 3.0E-19
sp|P43449|CCNA2_CHICK Cyclin-A2 OS=Gallus gallus GN=CCNA2 PE=2 SV=1 51 236 5.0E-19
sp|Q0JPA4|CCA12_ORYSJ Cyclin-A1-2 OS=Oryza sativa subsp. japonica GN=CYCA1-2 PE=3 SV=2 55 240 8.0E-19
sp|P37881|CCNA2_MESAU Cyclin-A2 OS=Mesocricetus auratus GN=CCNA2 PE=2 SV=1 51 243 9.0E-19
sp|Q0INT0|CCA13_ORYSJ Cyclin-A1-3 OS=Oryza sativa subsp. japonica GN=CYCA1-3 PE=2 SV=2 55 240 9.0E-19
sp|Q7F830|CCA11_ORYSJ Cyclin-A1-1 OS=Oryza sativa subsp. japonica GN=CYCA1-1 PE=2 SV=1 55 240 9.0E-19
sp|A0MEB5|CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana GN=CYCA3-3 PE=2 SV=2 85 240 1.0E-18
sp|P37882|CCNB1_MESAU G2/mitotic-specific cyclin-B1 OS=Mesocricetus auratus GN=CCNB1 PE=2 SV=1 51 244 1.0E-18
sp|P13952|CCNB_SPISO G2/mitotic-specific cyclin-B OS=Spisula solidissima PE=2 SV=1 47 240 1.0E-18
sp|P24860|CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus GN=Ccnb1 PE=1 SV=3 51 244 1.0E-18
sp|Q0JNK6|CCB13_ORYSJ Cyclin-B1-3 OS=Oryza sativa subsp. japonica GN=CYCB1-3 PE=2 SV=2 48 243 2.0E-18
sp|P51987|CCNB_HYDVD G2/mitotic-specific cyclin-B OS=Hydra viridissima PE=2 SV=1 51 236 2.0E-18
sp|Q2QQ96|CCA21_ORYSJ Cyclin-A2-1 OS=Oryza sativa subsp. japonica GN=CYCA2-1 PE=2 SV=1 13 244 3.0E-18
sp|Q9FVX0|CCA12_ARATH Cyclin-A1-2 OS=Arabidopsis thaliana GN=CYCA1-2 PE=1 SV=2 76 240 3.0E-18
sp|Q1LZG6|CCNB1_BOVIN G2/mitotic-specific cyclin-B1 OS=Bos taurus GN=CCNB1 PE=2 SV=1 51 244 3.0E-18
sp|P51988|CCNB_HYDVU G2/mitotic-specific cyclin-B (Fragment) OS=Hydra vulgaris PE=2 SV=1 51 222 4.0E-18
sp|Q39068|CCB21_ARATH Cyclin-B2-1 OS=Arabidopsis thaliana GN=CYCB2-1 PE=1 SV=2 48 243 4.0E-18
sp|P30277|CCNB1_RAT G2/mitotic-specific cyclin-B1 OS=Rattus norvegicus GN=Ccnb1 PE=2 SV=1 51 244 4.0E-18
sp|Q08301|CCNB1_CRIGR G2/mitotic-specific cyclin-B1 OS=Cricetulus griseus GN=CCNB1 PE=2 SV=1 51 244 5.0E-18
sp|P51986|CCNA_HYDVD G2/mitotic-specific cyclin-A (Fragment) OS=Hydra viridissima PE=2 SV=1 51 241 5.0E-18
sp|P24862|CCNB_PATVU G2/mitotic-specific cyclin-B OS=Patella vulgata PE=2 SV=1 47 285 6.0E-18
sp|P14635|CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens GN=CCNB1 PE=1 SV=1 51 244 7.0E-18
sp|Q75I54|CCA31_ORYSJ Cyclin-A3-1 OS=Oryza sativa subsp. japonica GN=CYCA3-1 PE=3 SV=1 52 215 7.0E-18
sp|Q9DG97|CCNB1_ORYLU G2/mitotic-specific cyclin-B1 OS=Oryzias luzonensis GN=ccnb1 PE=2 SV=1 51 244 7.0E-18
sp|Q60FX9|CCNB2_ANGJA G2/mitotic-specific cyclin-B2 OS=Anguilla japonica GN=ccnb2 PE=2 SV=1 47 240 8.0E-18
sp|Q147G5|CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana GN=CYCA2-2 PE=2 SV=1 84 244 1.0E-17
sp|Q5ALY0|CG21_CANAL G2/mitotic-specific cyclin CLB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB2 PE=1 SV=1 51 242 1.0E-17
sp|O93229|CCNB2_RANJA G2/mitotic-specific cyclin-B2 OS=Rana japonica GN=CCNB2 PE=2 SV=1 47 241 2.0E-17
sp|Q810T2|CCNB3_MOUSE G2/mitotic-specific cyclin-B3 OS=Mus musculus GN=Ccnb3 PE=1 SV=2 52 236 2.0E-17
sp|Q39071|CCA21_ARATH Cyclin-A2-1 OS=Arabidopsis thaliana GN=CYCA2-1 PE=2 SV=3 73 243 2.0E-17
sp|P47829|CG21_CANAX G2/mitotic-specific cyclin CYB1 OS=Candida albicans GN=CYB1 PE=2 SV=1 51 242 7.0E-17
sp|Q32NM1|CCNOB_XENLA Cyclin-O protein B OS=Xenopus laevis GN=ccno-b PE=2 SV=1 44 240 1.0E-16
sp|Q9C6A9|CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana GN=CYCA3-2 PE=2 SV=1 84 240 1.0E-16
sp|P30283|CGS5_YEAST S-phase entry cyclin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB5 PE=1 SV=1 22 245 2.0E-16
sp|Q9FMH5|CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana GN=CYCA3-1 PE=3 SV=1 77 240 2.0E-16
sp|Q60FY0|CCNB1_ANGJA G2/mitotic-specific cyclin-B1 OS=Anguilla japonica GN=ccnb1 PE=2 SV=1 51 244 3.0E-16
sp|Q9SFW6|CCB24_ARATH Cyclin-B2-4 OS=Arabidopsis thaliana GN=CYCB2-4 PE=2 SV=2 51 240 5.0E-16
sp|P13350|CCNB1_XENLA G2/mitotic-specific cyclin-B1 OS=Xenopus laevis GN=ccnb1 PE=1 SV=1 51 241 5.0E-16
sp|P22674|CCNO_HUMAN Cyclin-O OS=Homo sapiens GN=CCNO PE=1 SV=2 77 250 6.0E-16
sp|P42524|CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum GN=cycB PE=1 SV=1 47 243 6.0E-16
sp|Q9I7I0|CCNB3_DROME G2/mitotic-specific cyclin-B3 OS=Drosophila melanogaster GN=CycB3 PE=1 SV=1 52 249 7.0E-16
sp|Q32NJ2|CCNOA_XENLA Cyclin-O protein A OS=Xenopus laevis GN=ccno-a PE=2 SV=1 43 192 1.0E-15
sp|P47827|CCNA2_XENLA Cyclin-A2 OS=Xenopus laevis GN=ccna2 PE=2 SV=1 51 219 1.0E-15
sp|Q2QN26|CCA32_ORYSJ Cyclin-A3-2 OS=Oryza sativa subsp. japonica GN=CYCA3-2 PE=2 SV=1 51 215 2.0E-15
sp|P24868|CG21_YEAST G2/mitotic-specific cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB1 PE=1 SV=1 51 242 2.0E-15
sp|Q39070|CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana GN=CYCB2-2 PE=1 SV=2 48 244 3.0E-15
sp|P14785|CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster GN=CycA PE=1 SV=3 77 241 3.0E-15
sp|Q9C968|CCA24_ARATH Cyclin-A2-4 OS=Arabidopsis thaliana GN=CYCA2-4 PE=2 SV=1 76 243 3.0E-15
sp|Q6AY13|CCNA1_RAT Cyclin-A1 OS=Rattus norvegicus GN=Ccna1 PE=2 SV=1 51 242 5.0E-15
sp|Q61456|CCNA1_MOUSE Cyclin-A1 OS=Mus musculus GN=Ccna1 PE=1 SV=2 51 242 6.0E-15
sp|P78396|CCNA1_HUMAN Cyclin-A1 OS=Homo sapiens GN=CCNA1 PE=1 SV=1 51 242 7.0E-15
sp|P39963|CCNB3_CHICK G2/mitotic-specific cyclin-B3 OS=Gallus gallus GN=CCNB3 PE=2 SV=1 48 220 2.0E-14
sp|Q38819|CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana GN=CYCA2-3 PE=1 SV=2 77 244 2.0E-14
sp|P18606|CCNA1_XENLA Cyclin-A1 OS=Xenopus laevis GN=ccna1 PE=2 SV=1 48 242 3.0E-14
sp|P20437|CG11_YEAST G1/S-specific cyclin CLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN1 PE=1 SV=2 47 198 3.0E-14
sp|Q10653|CCNB1_CAEEL G2/mitotic-specific cyclin-B1 OS=Caenorhabditis elegans GN=cyb-1 PE=1 SV=1 84 236 3.0E-14
sp|Q92162|CCNB1_CARAU G2/mitotic-specific cyclin-B1 OS=Carassius auratus GN=ccnb1 PE=2 SV=1 51 241 8.0E-14
sp|Q3ECW2|CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana GN=CYCA3-4 PE=1 SV=1 76 240 8.0E-14
sp|O14332|REM1_SCHPO Meiosis-specific cyclin rem1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rem1 PE=3 SV=1 51 228 8.0E-14
sp|P18063|CCNB_PATPE G2/mitotic-specific cyclin-B OS=Patiria pectinifera PE=2 SV=2 47 221 1.0E-13
sp|P0C242|CCNO_MOUSE Cyclin-O OS=Mus musculus GN=Ccno PE=1 SV=1 77 252 2.0E-13
sp|Q10Q62|CCF32_ORYSJ Putative cyclin-F3-2 OS=Oryza sativa subsp. japonica GN=CYCF3-2 PE=3 SV=1 52 240 9.0E-13
sp|Q92161|CCNA1_CARAU Cyclin-A1 OS=Carassius auratus GN=ccna1 PE=2 SV=1 51 190 1.0E-12
sp|P20439|CCNB_DROME G2/mitotic-specific cyclin-B OS=Drosophila melanogaster GN=CycB PE=1 SV=2 51 236 1.0E-12
sp|P20438|CG12_YEAST G1/S-specific cyclin CLN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN2 PE=1 SV=2 70 188 2.0E-12
sp|Q659K0|CCNB3_CANLF G2/mitotic-specific cyclin-B3 OS=Canis lupus familiaris GN=CCNB3 PE=2 SV=1 52 236 4.0E-12
sp|Q10Q63|CCF31_ORYSJ Putative cyclin-F3-1 OS=Oryza sativa subsp. japonica GN=CYCF3-1 PE=3 SV=1 52 240 4.0E-12
sp|Q8WWL7|CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens GN=CCNB3 PE=1 SV=2 52 190 4.0E-11
sp|Q10654|CCNB3_CAEEL G2/mitotic-specific cyclin-B3 OS=Caenorhabditis elegans GN=cyb-3 PE=2 SV=3 79 243 2.0E-10
sp|P34638|CCNA1_CAEEL G2/mitotic-specific cyclin-A1 OS=Caenorhabditis elegans GN=cya-1 PE=1 SV=2 48 190 2.0E-10
sp|Q6DFJ9|CCNJ_XENLA Cyclin-J OS=Xenopus laevis GN=ccnj PE=2 SV=1 81 267 2.0E-09
sp|P41002|CCNF_HUMAN Cyclin-F OS=Homo sapiens GN=CCNF PE=1 SV=2 84 217 3.0E-09
sp|P50756|CCNE1_XENLA G1/S-specific cyclin-E1 OS=Xenopus laevis GN=cyce1 PE=2 SV=1 54 197 6.0E-09
sp|Q91780|CCNE2_XENLA G1/S-specific cyclin-E2 OS=Xenopus laevis GN=cyce2 PE=2 SV=1 54 197 6.0E-09
sp|A5PK16|CCNF_BOVIN Cyclin-F OS=Bos taurus GN=CCNF PE=2 SV=1 84 217 1.0E-08
sp|Q39072|CCB15_ARATH Cyclin-B1-5 OS=Arabidopsis thaliana GN=CYCB1-5 PE=2 SV=3 48 190 1.0E-08
sp|Q8MUK3|CCNE_CAEBR G1/S-specific cyclin-E OS=Caenorhabditis briggsae GN=cye-1 PE=2 SV=1 60 183 2.0E-08
sp|Q3TZI6|CCNJ_MOUSE Cyclin-J OS=Mus musculus GN=Ccnj PE=2 SV=2 81 267 2.0E-08
sp|P51944|CCNF_MOUSE Cyclin-F OS=Mus musculus GN=Ccnf PE=2 SV=2 84 217 3.0E-08
sp|Q5SCB5|CCND_OSTTA Cyclin-D OS=Ostreococcus tauri GN=CycD PE=3 SV=1 55 196 3.0E-08
sp|Q8K4F8|CCNF_RAT Cyclin-F OS=Rattus norvegicus GN=Ccnf PE=2 SV=2 84 217 3.0E-08
sp|Q7T0L6|CCNF_XENLA Cyclin-F OS=Xenopus laevis GN=ccnf PE=2 SV=1 68 220 4.0E-08
sp|Q5XGG5|CCNF_XENTR Cyclin-F OS=Xenopus tropicalis GN=ccnf PE=2 SV=1 72 220 4.0E-08
sp|Q5T5M9|CCNJ_HUMAN Cyclin-J OS=Homo sapiens GN=CCNJ PE=2 SV=2 84 267 3.0E-07
sp|P49707|CCNE1_CHICK G1/S-specific cyclin-E1 OS=Gallus gallus GN=CCNE1 PE=2 SV=1 54 187 5.0E-07
sp|O42575|CCNE3_XENLA G1/S-specific cyclin-E3 OS=Xenopus laevis GN=cyce3 PE=2 SV=1 54 197 6.0E-07
sp|P54733|CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster GN=CycE PE=1 SV=2 64 187 7.0E-07
sp|P39949|CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus GN=Ccne1 PE=2 SV=2 54 187 2.0E-06
sp|Q61457|CCNE1_MOUSE G1/S-specific cyclin-E1 OS=Mus musculus GN=Ccne1 PE=1 SV=2 54 187 4.0E-06
sp|P24864|CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens GN=CCNE1 PE=1 SV=2 54 187 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2578
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3104 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4479
Ophiocordyceps camponoti-floridani Ophcf2|03325
Ophiocordyceps camponoti-rufipedis Ophun1|4624
Ophiocordyceps kimflemingae Ophio5|6731
Ophiocordyceps subramaniannii Hirsu2|3865

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3104
MDYSKAPAHDGFFVEYDQCHGHIDSRTAAKMMARHRQDVIAGELSRQAADEYLDDMLKHMYTMEDETLADASLID
TQVEIQWYMRPYLIDFLVEAHAAFALLPETLHLTVNLLDRYCAKRVVFKHHYQLVGCAALLIASKYGDKKDRVPQ
ITELSNMCCGLYDSSMFVQMETHVLNTLGWTIGHPTVDFFTQLLVAYEPDDEVECMASFLSEIALYHRDFVSIKS
STMSRASLALARVVLGRSESVDRELHQEEFVAAESLSQFIEQPSPTLSRKYSSPSTFRVTDKLSEFVAARAIAFA
QAQRLAAVPPSPPAESAKSEGVYNTPHKPHVGTNAFDGYLTPPITPDGACFDSDMLHETYPLPPRCPVTPSPHQH
AQAYTHNSHHVGLPTRQHSLVPQP*
Coding >OphauG2|3104
ATGGATTATTCAAAAGCACCTGCCCACGACGGCTTCTTCGTCGAATACGACCAATGCCACGGTCACATTGATTCT
CGCACTGCAGCCAAGATGATGGCACGACATAGACAAGATGTAATTGCTGGAGAGCTCTCACGCCAGGCTGCCGAT
GAGTATCTCGATGATATGCTCAAGCACATGTACACCATGGAGGACGAGACTCTTGCAGACGCCAGCCTCATTGAT
ACCCAGGTCGAGATTCAATGGTACATGCGACCATATCTCATCGACTTCCTCGTCGAAGCCCATGCTGCCTTTGCC
TTGCTCCCTGAAACCCTGCACCTGACTGTCAACCTGCTGGACCGATACTGCGCCAAGAGAGTCGTCTTCAAGCAC
CATTATCAGCTCGTGGGCTGCGCTGCACTGCTCATTGCCTCCAAGTACGGTGACAAGAAGGATAGAGTCCCTCAG
ATCACGGAGCTGAGCAACATGTGCTGTGGTTTATACGACAGTAGCATGTTTGTTCAGATGGAGACGCATGTCCTG
AATACACTTGGATGGACTATTGGCCACCCAACCGTTGACTTTTTTACCCAGCTGCTGGTGGCTTACGAGCCAGAT
GACGAGGTGGAATGCATGGCTTCGTTCCTGAGTGAGATTGCACTTTACCACCGGGACTTTGTCTCGATCAAGTCG
TCAACAATGTCTCGCGCATCACTGGCACTGGCCCGAGTCGTCCTGGGACGCAGCGAATCTGTGGACCGAGAGTTG
CACCAAGAAGAGTTTGTGGCTGCTGAGTCGCTGTCACAATTTATCGAACAGCCCTCGCCCACGCTGTCGCGCAAG
TACTCGTCACCCAGCACCTTTCGCGTCACGGATAAGCTCAGCGAGTTTGTCGCAGCCCGGGCTATCGCCTTTGCC
CAGGCCCAACGCCTCGCTGCCGTCCCTCCGTCTCCCCCTGCCGAGTCAGCCAAGTCTGAGGGTGTTTACAATACG
CCCCACAAGCCTCACGTCGGTACCAATGCCTTTGACGGCTACTTGACACCCCCAATTACTCCAGATGGCGCTTGC
TTTGACAGCGATATGTTGCATGAAACTTATCCGCTGCCGCCTCGGTGTCCAGTCACGCCTTCACCTCATCAACAC
GCCCAGGCTTATACCCACAACTCACATCATGTGGGCCTGCCGACTCGGCAGCACAGCCTTGTTCCGCAGCCATAG
Transcript >OphauG2|3104
ATGGATTATTCAAAAGCACCTGCCCACGACGGCTTCTTCGTCGAATACGACCAATGCCACGGTCACATTGATTCT
CGCACTGCAGCCAAGATGATGGCACGACATAGACAAGATGTAATTGCTGGAGAGCTCTCACGCCAGGCTGCCGAT
GAGTATCTCGATGATATGCTCAAGCACATGTACACCATGGAGGACGAGACTCTTGCAGACGCCAGCCTCATTGAT
ACCCAGGTCGAGATTCAATGGTACATGCGACCATATCTCATCGACTTCCTCGTCGAAGCCCATGCTGCCTTTGCC
TTGCTCCCTGAAACCCTGCACCTGACTGTCAACCTGCTGGACCGATACTGCGCCAAGAGAGTCGTCTTCAAGCAC
CATTATCAGCTCGTGGGCTGCGCTGCACTGCTCATTGCCTCCAAGTACGGTGACAAGAAGGATAGAGTCCCTCAG
ATCACGGAGCTGAGCAACATGTGCTGTGGTTTATACGACAGTAGCATGTTTGTTCAGATGGAGACGCATGTCCTG
AATACACTTGGATGGACTATTGGCCACCCAACCGTTGACTTTTTTACCCAGCTGCTGGTGGCTTACGAGCCAGAT
GACGAGGTGGAATGCATGGCTTCGTTCCTGAGTGAGATTGCACTTTACCACCGGGACTTTGTCTCGATCAAGTCG
TCAACAATGTCTCGCGCATCACTGGCACTGGCCCGAGTCGTCCTGGGACGCAGCGAATCTGTGGACCGAGAGTTG
CACCAAGAAGAGTTTGTGGCTGCTGAGTCGCTGTCACAATTTATCGAACAGCCCTCGCCCACGCTGTCGCGCAAG
TACTCGTCACCCAGCACCTTTCGCGTCACGGATAAGCTCAGCGAGTTTGTCGCAGCCCGGGCTATCGCCTTTGCC
CAGGCCCAACGCCTCGCTGCCGTCCCTCCGTCTCCCCCTGCCGAGTCAGCCAAGTCTGAGGGTGTTTACAATACG
CCCCACAAGCCTCACGTCGGTACCAATGCCTTTGACGGCTACTTGACACCCCCAATTACTCCAGATGGCGCTTGC
TTTGACAGCGATATGTTGCATGAAACTTATCCGCTGCCGCCTCGGTGTCCAGTCACGCCTTCACCTCATCAACAC
GCCCAGGCTTATACCCACAACTCACATCATGTGGGCCTGCCGACTCGGCAGCACAGCCTTGTTCCGCAGCCATAG
Gene >OphauG2|3104
ATGGATTATTCAAAAGCACCTGCCCACGACGGCTTCTTCGTCGAATACGACCAATGCCACGGTCACATTGATTCT
CGCACTGCAGCCAAGATGATGGCACGACATAGACAAGATGTAATTGCTGGAGAGCTCTCACGCCAGGCTGCCGAT
GAGTATCTCGATGATATGCTCAAGCACATGTACACCATGGAGGCATGTTTCTCCCGCCTTCAATTCGTCCTGTGC
CTCGGCCTTGACCATGACTGACCATGTTTGCAGGACGAGACTCTTGCAGACGCCAGCCTCATTGATACCCAGGTC
GAGATTCAATGGTACATGCGACCATATCTCATCGACTTCCTCGTCGAAGCCCATGCTGCCTTTGCCTTGCTCCCT
GAAACCCTGCACCTGACTGTCAACCTGCTGGACCGATACTGCGCCAAGAGAGTCGTCTTCAAGCACCATTATCAG
CTCGTGGGCTGCGCTGCACTGCTCATTGCCTCCAAGTACGGTGACAAGAAGGATAGAGTCCCTCAGATCACGGAG
CTGAGCAACATGTGCTGTGGTTTATACGACAGTAGCATGTTTGTTCAGATGGAGACGCATGTCCTGAATACACTT
GGATGGACTATTGGCCACCCAACCGTTGACTTTTTTACCCAGCTGCTGGTGGCTTACGAGCCAGATGACGAGGTG
GAATGCATGGCTTCGTTCCTGAGTGAGATTGCACTTTACCACCGGGACTTTGTCTCGATCAAGTCGTCAACAATG
TCTCGCGCATCACTGGCACTGGCCCGAGTCGTCCTGGGACGCAGCGAATCTGTGGACCGAGAGTTGCACCAAGAA
GAGTTTGTGGCTGCTGAGTCGCTGTCACAATTTATCGAACAGCCCTCGCCCACGCTGTCGCGCAAGTACTCGTCA
CCCAGCACCTTTCGCGTCACGGATAAGCTCAGCGAGTTTGTCGCAGCCCGGGCTATCGCCTTTGCCCAGGCCCAA
CGCCTCGCTGCCGTCCCTCCGTCTCCCCCTGCCGAGTCAGCCAAGTCTGAGGGTGTTTACAATACGCCCCACAAG
CCTCACGTCGGTACCAATGCCTTTGACGGCTACTTGACACCCCCAATTACTCCAGATGGCGCTTGCTTTGACAGC
GATATGTTGCATGAAACTTATCCGCTGCCGCCTCGGTGTCCAGTCACGCCTTCACCTCATCAACACGCCCAGGCT
TATACCCACAACTCACATCATGTGGGCCTGCCGACTCGGCAGCACAGCCTTGTTCCGCAGCCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail