Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3102
Gene name
LocationContig_228:11270..12320
Strand+
Gene length (bp)1050
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain 3.3E-26 94 158
PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain 5.2E-23 178 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25443|RS2_YEAST 40S ribosomal protein S2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS2 PE=1 SV=3 48 263 1.0E-120
sp|O74892|RS2_SCHPO 40S ribosomal protein S2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2 PE=1 SV=1 47 270 5.0E-118
sp|P49688|RS23_ARATH 40S ribosomal protein S2-3 OS=Arabidopsis thaliana GN=RPS2C PE=1 SV=2 48 265 3.0E-108
sp|Q9SCM3|RS24_ARATH 40S ribosomal protein S2-4 OS=Arabidopsis thaliana GN=RPS2D PE=2 SV=1 49 265 5.0E-108
sp|Q90YS3|RS2_ICTPU 40S ribosomal protein S2 OS=Ictalurus punctatus GN=rps2 PE=2 SV=1 29 265 1.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25443|RS2_YEAST 40S ribosomal protein S2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS2 PE=1 SV=3 48 263 1.0E-120
sp|O74892|RS2_SCHPO 40S ribosomal protein S2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2 PE=1 SV=1 47 270 5.0E-118
sp|P49688|RS23_ARATH 40S ribosomal protein S2-3 OS=Arabidopsis thaliana GN=RPS2C PE=1 SV=2 48 265 3.0E-108
sp|Q9SCM3|RS24_ARATH 40S ribosomal protein S2-4 OS=Arabidopsis thaliana GN=RPS2D PE=2 SV=1 49 265 5.0E-108
sp|Q90YS3|RS2_ICTPU 40S ribosomal protein S2 OS=Ictalurus punctatus GN=rps2 PE=2 SV=1 29 265 1.0E-107
sp|Q93VB8|RS22_ARATH 40S ribosomal protein S2-2 OS=Arabidopsis thaliana GN=RPS2B PE=2 SV=1 48 265 3.0E-107
sp|Q8L8Y0|RS21_ARATH 40S ribosomal protein S2-1 OS=Arabidopsis thaliana GN=RPS2A PE=2 SV=2 48 265 3.0E-107
sp|P15880|RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 47 265 7.0E-106
sp|P27952|RS2_RAT 40S ribosomal protein S2 OS=Rattus norvegicus GN=Rps2 PE=1 SV=1 47 265 2.0E-105
sp|P25444|RS2_MOUSE 40S ribosomal protein S2 OS=Mus musculus GN=Rps2 PE=1 SV=3 47 265 2.0E-105
sp|O18789|RS2_BOVIN 40S ribosomal protein S2 OS=Bos taurus GN=RPS2 PE=2 SV=2 47 265 2.0E-105
sp|P27685|RS2_DICDI 40S ribosomal protein S2 OS=Dictyostelium discoideum GN=rps2 PE=1 SV=1 1 270 3.0E-105
sp|P31009|RS2_DROME 40S ribosomal protein S2 OS=Drosophila melanogaster GN=RpS2 PE=1 SV=2 47 265 3.0E-105
sp|P51403|RS2_CAEEL 40S ribosomal protein S2 OS=Caenorhabditis elegans GN=rps-2 PE=3 SV=1 49 265 9.0E-100
sp|P46791|RS2_CRIGR 40S ribosomal protein S2 (Fragment) OS=Cricetulus griseus GN=RPS2 PE=2 SV=1 55 251 2.0E-96
sp|P49154|RS2_URECA 40S ribosomal protein S2 OS=Urechis caupo GN=RPS2 PE=2 SV=1 46 265 8.0E-96
sp|O43992|RS2_LEIAM 40S ribosomal protein S2 OS=Leishmania amazonensis PE=3 SV=1 49 267 2.0E-94
sp|Q975K0|RS5_SULTO 30S ribosomal protein S5 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps5 PE=3 SV=1 51 248 3.0E-62
sp|C3NH89|RS5_SULIN 30S ribosomal protein S5 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps5 PE=3 SV=1 51 252 8.0E-61
sp|Q9UX87|RS5_SULSO 30S ribosomal protein S5 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps5 PE=3 SV=2 51 252 1.0E-60
sp|Q9YF95|RS5_AERPE 30S ribosomal protein S5 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps5 PE=3 SV=1 43 253 2.0E-60
sp|A1RWR6|RS5_THEPD 30S ribosomal protein S5 OS=Thermofilum pendens (strain Hrk 5) GN=rps5 PE=3 SV=1 52 248 1.0E-58
sp|O05641|RS5_SULAC 30S ribosomal protein S5 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps5 PE=3 SV=1 51 248 2.0E-58
sp|A4YCY6|RS5_METS5 30S ribosomal protein S5 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps5 PE=3 SV=1 48 252 7.0E-56
sp|A2BMD9|RS5_HYPBU 30S ribosomal protein S5 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps5 PE=3 SV=1 50 251 7.0E-56
sp|A8AC00|RS5_IGNH4 30S ribosomal protein S5 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps5 PE=3 SV=1 51 248 3.0E-55
sp|A3MU88|RS5_PYRCJ 30S ribosomal protein S5 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps5 PE=3 SV=1 53 242 4.0E-55
sp|A1RU37|RS5_PYRIL 30S ribosomal protein S5 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps5 PE=3 SV=1 53 242 3.0E-54
sp|A4WHQ8|RS5_PYRAR 30S ribosomal protein S5 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps5 PE=3 SV=2 53 242 3.0E-53
sp|Q8ZXN9|RS5_PYRAE 30S ribosomal protein S5 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps5 PE=3 SV=1 53 242 8.0E-53
sp|Q6LXD3|RS5_METMP 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps5 PE=3 SV=1 47 238 1.0E-52
sp|A9A9P4|RS5_METM6 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps5 PE=3 SV=1 47 238 1.0E-52
sp|A4FWA1|RS5_METM5 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps5 PE=3 SV=1 47 238 6.0E-52
sp|A6VH05|RS5_METM7 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps5 PE=3 SV=1 47 238 1.0E-51
sp|A0B9V0|RS5_METTP 30S ribosomal protein S5 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps5 PE=3 SV=1 49 239 1.0E-50
sp|Q2FSG3|RS5_METHJ 30S ribosomal protein S5 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps5 PE=3 SV=1 49 239 2.0E-50
sp|Q12ZT1|RS5_METBU 30S ribosomal protein S5 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps5 PE=3 SV=1 50 251 3.0E-50
sp|Q46GB5|RS5_METBF 30S ribosomal protein S5 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps5 PE=3 SV=1 50 250 3.0E-50
sp|O28374|RS5_ARCFU 30S ribosomal protein S5 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps5 PE=3 SV=1 51 239 4.0E-50
sp|P54045|RS5_METJA 30S ribosomal protein S5 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps5 PE=3 SV=1 52 238 9.0E-50
sp|Q9HPB4|RS5_HALSA 30S ribosomal protein S5 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps5 PE=3 SV=1 53 252 1.0E-49
sp|Q3IMW8|RS5_NATPD 30S ribosomal protein S5 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps5 PE=3 SV=1 53 260 1.0E-49
sp|P26815|RS5_HALMA 30S ribosomal protein S5 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps5 PE=3 SV=1 53 245 3.0E-49
sp|Q9HIS7|RS5_THEAC 30S ribosomal protein S5 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps5 PE=3 SV=1 51 239 3.0E-49
sp|Q8TRS7|RS5_METAC 30S ribosomal protein S5 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps5 PE=3 SV=1 50 239 6.0E-49
sp|Q8PV30|RS5_METMA 30S ribosomal protein S5 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps5 PE=3 SV=1 50 239 6.0E-49
sp|Q18GG9|RS5_HALWD 30S ribosomal protein S5 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps5 PE=3 SV=1 53 245 7.0E-49
sp|A6UQ64|RS5_METVS 30S ribosomal protein S5 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps5 PE=3 SV=1 47 238 8.0E-49
sp|P14036|RS5_METVA 30S ribosomal protein S5 OS=Methanococcus vannielii GN=rps5 PE=3 SV=1 47 238 8.0E-49
sp|Q97BV6|RS5_THEVO 30S ribosomal protein S5 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps5 PE=3 SV=1 52 239 1.0E-48
sp|A2SPM2|RS5_METLZ 30S ribosomal protein S5 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps5 PE=3 SV=1 49 239 2.0E-48
sp|A3CT17|RS5_METMJ 30S ribosomal protein S5 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps5 PE=3 SV=1 50 239 3.0E-48
sp|A7I5Q9|RS5_METB6 30S ribosomal protein S5 OS=Methanoregula boonei (strain 6A8) GN=rps5 PE=3 SV=1 49 239 1.0E-47
sp|O26131|RS5_METTH 30S ribosomal protein S5 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps5 PE=3 SV=1 51 236 1.0E-47
sp|Q0W1W8|RS5_METAR 30S ribosomal protein S5 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps5 PE=3 SV=1 49 239 8.0E-47
sp|A6UWV8|RS5_META3 30S ribosomal protein S5 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps5 PE=3 SV=1 53 238 8.0E-47
sp|Q8U017|RS5_PYRFU 30S ribosomal protein S5 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps5 PE=1 SV=1 52 239 1.0E-45
sp|O59439|RS5_PYRHO 30S ribosomal protein S5 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps5 PE=3 SV=1 52 239 2.0E-45
sp|Q5JJG8|RS5_THEKO 30S ribosomal protein S5 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps5 PE=3 SV=1 51 239 2.0E-45
sp|Q9V1V5|RS5_PYRAB 30S ribosomal protein S5 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps5 PE=3 SV=1 52 247 5.0E-45
sp|Q74MD4|RS5_NANEQ 30S ribosomal protein S5 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps5 PE=3 SV=1 51 236 5.0E-45
sp|Q8TZA6|RS5_METKA 30S ribosomal protein S5 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps5 PE=3 SV=1 51 238 1.0E-44
sp|A3DNC7|RS5_STAMF 30S ribosomal protein S5 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps5 PE=3 SV=1 47 248 2.0E-44
sp|A5UL68|RS5_METS3 30S ribosomal protein S5 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps5 PE=3 SV=1 52 236 7.0E-44
sp|Q6L1A7|RS5_PICTO 30S ribosomal protein S5 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps5 PE=3 SV=1 50 242 3.0E-41
sp|A0RUE7|RS5_CENSY 30S ribosomal protein S5 OS=Cenarchaeum symbiosum (strain A) GN=rps5 PE=3 SV=1 53 240 7.0E-41
sp|Q2NFX7|RS5_METST 30S ribosomal protein S5 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps5 PE=3 SV=1 51 236 2.0E-37
sp|A0M581|RS5_GRAFK 30S ribosomal protein S5 OS=Gramella forsetii (strain KT0803) GN=rpsE PE=3 SV=1 82 236 2.0E-20
sp|A6GZ82|RS5_FLAPJ 30S ribosomal protein S5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsE PE=3 SV=1 83 236 6.0E-19
sp|Q9PQP3|RS5_UREPA 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsE PE=3 SV=1 88 233 1.0E-18
sp|B1AIN7|RS5_UREP2 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsE PE=3 SV=1 88 233 1.0E-18
sp|B5ZB57|RS5_UREU1 30S ribosomal protein S5 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsE PE=3 SV=1 88 233 1.0E-18
sp|Q38US8|RS5_LACSS 30S ribosomal protein S5 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsE PE=3 SV=1 87 233 2.0E-18
sp|P93014|RR5_ARATH 30S ribosomal protein S5, chloroplastic OS=Arabidopsis thaliana GN=rps5 PE=2 SV=1 94 242 2.0E-18
sp|Q81J25|RS5_BACCR 30S ribosomal protein S5 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsE PE=3 SV=1 93 237 2.0E-18
sp|A0R8J7|RS5_BACAH 30S ribosomal protein S5 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsE PE=3 SV=1 93 237 2.0E-18
sp|Q6HPP1|RS5_BACHK 30S ribosomal protein S5 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsE PE=3 SV=1 93 237 2.0E-18
sp|Q63H73|RS5_BACCZ 30S ribosomal protein S5 OS=Bacillus cereus (strain ZK / E33L) GN=rpsE PE=3 SV=1 93 237 2.0E-18
sp|Q73F79|RS5_BACC1 30S ribosomal protein S5 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsE PE=3 SV=1 93 237 2.0E-18
sp|Q81VR3|RS5_BACAN 30S ribosomal protein S5 OS=Bacillus anthracis GN=rpsE PE=3 SV=1 93 237 2.0E-18
sp|Q5WLP5|RS5_BACSK 30S ribosomal protein S5 OS=Bacillus clausii (strain KSM-K16) GN=rpsE PE=3 SV=1 87 238 3.0E-18
sp|A5USH2|RS5_ROSS1 30S ribosomal protein S5 OS=Roseiflexus sp. (strain RS-1) GN=rpsE PE=3 SV=1 93 257 3.0E-18
sp|B3QYE1|RS5_CHLT3 30S ribosomal protein S5 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpsE PE=3 SV=1 94 240 3.0E-18
sp|A7GK37|RS5_BACCN 30S ribosomal protein S5 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsE PE=3 SV=1 87 237 5.0E-18
sp|Q9ST69|RR5_SPIOL 30S ribosomal protein S5, chloroplastic OS=Spinacia oleracea GN=rps5 PE=1 SV=1 94 242 6.0E-18
sp|P59123|RS5_OCEIH 30S ribosomal protein S5 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsE PE=3 SV=1 94 238 1.0E-17
sp|B9MKG4|RS5_CALBD 30S ribosomal protein S5 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsE PE=3 SV=1 94 236 1.0E-17
sp|O52349|RS5_MYCGA 30S ribosomal protein S5 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpsE PE=3 SV=2 93 240 2.0E-17
sp|A4XLR3|RS5_CALS8 30S ribosomal protein S5 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsE PE=3 SV=1 94 236 2.0E-17
sp|B4SBW4|RS5_PELPB 30S ribosomal protein S5 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsE PE=3 SV=1 94 240 3.0E-17
sp|Q0SQG1|RS5_CLOPS 30S ribosomal protein S5 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsE PE=3 SV=1 87 238 3.0E-17
sp|Q8XHU0|RS5_CLOPE 30S ribosomal protein S5 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsE PE=3 SV=1 87 238 3.0E-17
sp|Q0TMR3|RS5_CLOP1 30S ribosomal protein S5 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsE PE=3 SV=1 87 238 3.0E-17
sp|B9DM30|RS5_STACT 30S ribosomal protein S5 OS=Staphylococcus carnosus (strain TM300) GN=rpsE PE=3 SV=1 93 238 3.0E-17
sp|P21467|RS5_BACSU 30S ribosomal protein S5 OS=Bacillus subtilis (strain 168) GN=rpsE PE=1 SV=3 87 237 4.0E-17
sp|A7Z0Q5|RS5_BACMF 30S ribosomal protein S5 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsE PE=3 SV=1 87 237 5.0E-17
sp|Q65P90|RS5_BACLD 30S ribosomal protein S5 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsE PE=3 SV=1 87 237 5.0E-17
sp|Q1ISA5|RS5_KORVE 30S ribosomal protein S5 OS=Koribacter versatilis (strain Ellin345) GN=rpsE PE=3 SV=1 94 236 5.0E-17
sp|A8F9A2|RS5_BACP2 30S ribosomal protein S5 OS=Bacillus pumilus (strain SAFR-032) GN=rpsE PE=3 SV=1 87 237 5.0E-17
sp|Q8EUD0|RS5_MYCPE 30S ribosomal protein S5 OS=Mycoplasma penetrans (strain HF-2) GN=rpsE PE=3 SV=1 82 233 6.0E-17
sp|P02357|RS5_GEOSE 30S ribosomal protein S5 OS=Geobacillus stearothermophilus GN=rpsE PE=1 SV=1 93 233 6.0E-17
sp|Q5L3S2|RS5_GEOKA 30S ribosomal protein S5 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsE PE=3 SV=1 87 233 6.0E-17
sp|A4IJK5|RS5_GEOTN 30S ribosomal protein S5 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsE PE=3 SV=1 87 233 8.0E-17
sp|Q03ED3|RS5_PEDPA 30S ribosomal protein S5 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsE PE=3 SV=1 85 233 8.0E-17
sp|Q8KAI8|RS5_CHLTE 30S ribosomal protein S5 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpsE PE=3 SV=1 94 238 9.0E-17
sp|Q4G352|RR5_EMIHU 30S ribosomal protein S5, chloroplastic OS=Emiliania huxleyi GN=rps5 PE=3 SV=1 95 243 9.0E-17
sp|B4S5B1|RS5_PROA2 30S ribosomal protein S5 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsE PE=3 SV=1 94 240 1.0E-16
sp|Q03PX4|RS5_LACBA 30S ribosomal protein S5 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsE PE=3 SV=1 85 233 1.0E-16
sp|Q3APJ0|RS5_CHLCH 30S ribosomal protein S5 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsE PE=3 SV=1 94 240 2.0E-16
sp|B3EGX3|RS5_CHLL2 30S ribosomal protein S5 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsE PE=3 SV=1 94 233 2.0E-16
sp|A1BJ17|RS5_CHLPD 30S ribosomal protein S5 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsE PE=3 SV=1 94 240 2.0E-16
sp|B3EP44|RS5_CHLPB 30S ribosomal protein S5 OS=Chlorobium phaeobacteroides (strain BS1) GN=rpsE PE=3 SV=1 94 240 3.0E-16
sp|B0TC73|RS5_HELMI 30S ribosomal protein S5 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsE PE=3 SV=1 87 233 3.0E-16
sp|Q9Z9J7|RS5_BACHD 30S ribosomal protein S5 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsE PE=3 SV=1 87 233 3.0E-16
sp|Q50301|RS5_MYCPN 30S ribosomal protein S5 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsE PE=3 SV=1 90 236 3.0E-16
sp|O67563|RS5_AQUAE 30S ribosomal protein S5 OS=Aquifex aeolicus (strain VF5) GN=rpsE PE=3 SV=1 82 271 3.0E-16
sp|Q3B6E5|RS5_CHLL7 30S ribosomal protein S5 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsE PE=3 SV=1 94 233 3.0E-16
sp|A3DJI9|RS5_CLOTH 30S ribosomal protein S5 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsE PE=3 SV=1 84 237 4.0E-16
sp|B8G1Y3|RS5_DESHD 30S ribosomal protein S5 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsE PE=3 SV=1 87 236 4.0E-16
sp|Q2IJ66|RS5_ANADE 30S ribosomal protein S5 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsE PE=3 SV=1 93 234 5.0E-16
sp|B3QR82|RS5_CHLP8 30S ribosomal protein S5 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsE PE=3 SV=1 94 233 5.0E-16
sp|Q97EJ5|RS5_CLOAB 30S ribosomal protein S5 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsE PE=3 SV=1 87 237 5.0E-16
sp|Q88XW9|RS5_LACPL 30S ribosomal protein S5 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsE PE=3 SV=1 94 233 5.0E-16
sp|A4SCS6|RS5_CHLPM 30S ribosomal protein S5 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsE PE=3 SV=1 94 233 5.0E-16
sp|Q04G69|RS5_OENOB 30S ribosomal protein S5 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsE PE=3 SV=1 81 238 6.0E-16
sp|Q035A0|RS5_LACC3 30S ribosomal protein S5 OS=Lactobacillus casei (strain ATCC 334) GN=rpsE PE=3 SV=1 87 233 6.0E-16
sp|B1HMW3|RS5_LYSSC 30S ribosomal protein S5 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsE PE=3 SV=1 91 237 6.0E-16
sp|C5D3T4|RS5_GEOSW 30S ribosomal protein S5 OS=Geobacillus sp. (strain WCH70) GN=rpsE PE=3 SV=1 87 233 7.0E-16
sp|Q250L5|RS5_DESHY 30S ribosomal protein S5 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsE PE=3 SV=1 87 236 8.0E-16
sp|Q3A9T3|RS5_CARHZ 30S ribosomal protein S5 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsE PE=3 SV=1 87 236 8.0E-16
sp|A6TWG5|RS5_ALKMQ 30S ribosomal protein S5 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsE PE=3 SV=1 87 233 1.0E-15
sp|B7GJ84|RS5_ANOFW 30S ribosomal protein S5 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsE PE=3 SV=1 87 233 1.0E-15
sp|Q1D758|RS5_MYXXD 30S ribosomal protein S5 OS=Myxococcus xanthus (strain DK 1622) GN=rpsE PE=3 SV=1 94 234 1.0E-15
sp|Q055C7|RS5_LEPBL 30S ribosomal protein S5 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpsE1 PE=3 SV=1 96 236 1.0E-15
sp|Q04PV5|RS5_LEPBJ 30S ribosomal protein S5 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsE PE=3 SV=1 96 236 1.0E-15
sp|A5VLI8|RS5_LACRD 30S ribosomal protein S5 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsE PE=3 SV=1 85 233 1.0E-15
sp|Q4L897|RS5_STAHJ 30S ribosomal protein S5 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|P66580|RS5_STAAW 30S ribosomal protein S5 OS=Staphylococcus aureus (strain MW2) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|A8Z340|RS5_STAAT 30S ribosomal protein S5 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q6G788|RS5_STAAS 30S ribosomal protein S5 OS=Staphylococcus aureus (strain MSSA476) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q6GEK0|RS5_STAAR 30S ribosomal protein S5 OS=Staphylococcus aureus (strain MRSA252) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|P66579|RS5_STAAN 30S ribosomal protein S5 OS=Staphylococcus aureus (strain N315) GN=rpsE PE=1 SV=1 98 238 2.0E-15
sp|P66578|RS5_STAAM 30S ribosomal protein S5 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q5HDX5|RS5_STAAC 30S ribosomal protein S5 OS=Staphylococcus aureus (strain COL) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q2YYL4|RS5_STAAB 30S ribosomal protein S5 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|A5IV17|RS5_STAA9 30S ribosomal protein S5 OS=Staphylococcus aureus (strain JH9) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q2FW23|RS5_STAA8 30S ribosomal protein S5 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q2FEQ6|RS5_STAA3 30S ribosomal protein S5 OS=Staphylococcus aureus (strain USA300) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|A6U3V8|RS5_STAA2 30S ribosomal protein S5 OS=Staphylococcus aureus (strain JH1) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|A7X5D8|RS5_STAA1 30S ribosomal protein S5 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|A6QJ75|RS5_STAAE 30S ribosomal protein S5 OS=Staphylococcus aureus (strain Newman) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q8CRH7|RS5_STAES 30S ribosomal protein S5 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|Q5HM16|RS5_STAEQ 30S ribosomal protein S5 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsE PE=3 SV=1 98 238 2.0E-15
sp|A8MLF7|RS5_ALKOO 30S ribosomal protein S5 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsE PE=3 SV=1 87 237 2.0E-15
sp|Q49ZF1|RS5_STAS1 30S ribosomal protein S5 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsE PE=3 SV=1 93 238 2.0E-15
sp|Q6KI38|RS5_MYCMO 30S ribosomal protein S5 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsE PE=3 SV=1 98 236 3.0E-15
sp|A5D5H1|RS5_PELTS 30S ribosomal protein S5 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsE PE=3 SV=1 96 261 3.0E-15
sp|A7GJ57|RS5_CLOBL 30S ribosomal protein S5 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpsE PE=3 SV=1 87 233 3.0E-15
sp|A5I7I9|RS5_CLOBH 30S ribosomal protein S5 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpsE PE=3 SV=1 87 233 3.0E-15
sp|A7FQ40|RS5_CLOB1 30S ribosomal protein S5 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpsE PE=3 SV=1 87 233 3.0E-15
sp|Q9XD19|RS5_LEPIN 30S ribosomal protein S5 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpsE PE=3 SV=3 96 236 3.0E-15
sp|Q72NH8|RS5_LEPIC 30S ribosomal protein S5 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpsE PE=3 SV=3 96 236 3.0E-15
sp|Q64NM5|RS5_BACFR 30S ribosomal protein S5 OS=Bacteroides fragilis (strain YCH46) GN=rpsE PE=3 SV=1 93 236 3.0E-15
sp|Q5L8C6|RS5_BACFN 30S ribosomal protein S5 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsE PE=3 SV=1 93 236 3.0E-15
sp|A4J128|RS5_DESRM 30S ribosomal protein S5 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsE PE=3 SV=1 87 233 4.0E-15
sp|Q8A493|RS5_BACTN 30S ribosomal protein S5 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsE PE=3 SV=1 93 237 4.0E-15
sp|Q839E7|RS5_ENTFA 30S ribosomal protein S5 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsE PE=3 SV=1 93 233 5.0E-15
sp|A0PXW3|RS5_CLONN 30S ribosomal protein S5 OS=Clostridium novyi (strain NT) GN=rpsE PE=3 SV=1 87 237 7.0E-15
sp|A0T0J5|RR5_PHATC 30S ribosomal protein S5, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps5 PE=3 SV=1 85 238 9.0E-15
sp|Q6F1X7|RS5_MESFL 30S ribosomal protein S5 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsE PE=3 SV=1 82 240 9.0E-15
sp|Q18CH3|RS5_PEPD6 30S ribosomal protein S5 OS=Peptoclostridium difficile (strain 630) GN=rpsE PE=3 SV=1 94 233 9.0E-15
sp|Q1MPP8|RS5_LAWIP 30S ribosomal protein S5 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsE PE=3 SV=1 96 237 1.0E-14
sp|B0C1E9|RS5_ACAM1 30S ribosomal protein S5 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsE PE=3 SV=1 95 251 2.0E-14
sp|A6Q1J5|RS5_NITSB 30S ribosomal protein S5 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsE PE=3 SV=1 93 222 2.0E-14
sp|A6LEH4|RS5_PARD8 30S ribosomal protein S5 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsE PE=3 SV=1 93 236 2.0E-14
sp|Q2LQC0|RS5_SYNAS 30S ribosomal protein S5 OS=Syntrophus aciditrophicus (strain SB) GN=rpsE PE=3 SV=1 96 233 2.0E-14
sp|A6KYH8|RS5_BACV8 30S ribosomal protein S5 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsE PE=3 SV=1 93 236 2.0E-14
sp|B3E847|RS5_GEOLS 30S ribosomal protein S5 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsE PE=3 SV=1 93 233 3.0E-14
sp|A1VE99|RS5_DESVV 30S ribosomal protein S5 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsE PE=3 SV=1 94 238 4.0E-14
sp|Q72CG3|RS5_DESVH 30S ribosomal protein S5 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsE PE=3 SV=1 94 238 4.0E-14
sp|P23402|RR5_CYAPA 30S ribosomal protein S5, cyanelle OS=Cyanophora paradoxa GN=rps5 PE=3 SV=1 92 242 4.0E-14
sp|A0ALV1|RS5_LISW6 30S ribosomal protein S5 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsE PE=3 SV=1 94 233 4.0E-14
sp|Q8Y446|RS5_LISMO 30S ribosomal protein S5 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsE PE=3 SV=1 94 233 4.0E-14
sp|Q71WG3|RS5_LISMF 30S ribosomal protein S5 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsE PE=3 SV=1 94 233 4.0E-14
sp|Q927M4|RS5_LISIN 30S ribosomal protein S5 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsE PE=3 SV=1 94 233 4.0E-14
sp|B9LJE9|RS5_CHLSY 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsE PE=3 SV=1 93 255 4.0E-14
sp|A9WH83|RS5_CHLAA 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsE PE=3 SV=1 93 255 4.0E-14
sp|A8AZK8|RS5_STRGC 30S ribosomal protein S5 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsE PE=3 SV=1 93 233 4.0E-14
sp|P0DE95|RS5_STRPQ 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|Q48VT2|RS5_STRPM 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|A2RC31|RS5_STRPG 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|Q1J8Z6|RS5_STRPF 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|Q1JJ45|RS5_STRPD 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|Q1JP00|RS5_STRPC 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|Q1JE42|RS5_STRPB 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|P66585|RS5_STRP8 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|Q5XEB8|RS5_STRP6 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|P0DE94|RS5_STRP3 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|P66583|RS5_STRP1 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M1 GN=rpsE PE=3 SV=1 93 233 5.0E-14
sp|B1XJJ1|RS5_SYNP2 30S ribosomal protein S5 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsE PE=3 SV=1 95 242 5.0E-14
sp|P47414|RS5_MYCGE 30S ribosomal protein S5 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsE PE=3 SV=1 94 261 6.0E-14
sp|Q2RFR4|RS5_MOOTA 30S ribosomal protein S5 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsE PE=3 SV=1 94 242 6.0E-14
sp|Q6YR05|RS5_ONYPE 30S ribosomal protein S5 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsE PE=3 SV=1 92 233 7.0E-14
sp|O51448|RS5_BORBU 30S ribosomal protein S5 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsE PE=3 SV=1 96 235 8.0E-14
sp|B1LBM3|RS5_THESQ 30S ribosomal protein S5 OS=Thermotoga sp. (strain RQ2) GN=rpsE PE=3 SV=1 106 245 8.0E-14
sp|A5IMA0|RS5_THEP1 30S ribosomal protein S5 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsE PE=3 SV=1 106 245 8.0E-14
sp|A7HM35|RS5_FERNB 30S ribosomal protein S5 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsE PE=3 SV=1 94 242 8.0E-14
sp|A7HBN5|RS5_ANADF 30S ribosomal protein S5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsE PE=3 SV=1 93 234 8.0E-14
sp|A7ZFZ5|RS5_CAMC1 30S ribosomal protein S5 OS=Campylobacter concisus (strain 13826) GN=rpsE PE=3 SV=1 93 237 9.0E-14
sp|B2S2F3|RS5_TREPS 30S ribosomal protein S5 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsE PE=3 SV=1 93 238 9.0E-14
sp|O83236|RS5_TREPA 30S ribosomal protein S5 OS=Treponema pallidum (strain Nichols) GN=rpsE PE=3 SV=1 93 238 9.0E-14
sp|Q3A6N0|RS5_PELCD 30S ribosomal protein S5 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsE PE=3 SV=1 87 237 9.0E-14
sp|Q6ME47|RS5_PARUW 30S ribosomal protein S5 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsE PE=3 SV=1 94 252 1.0E-13
sp|O24705|RS5_SYNP6 30S ribosomal protein S5 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsE PE=3 SV=1 95 242 1.0E-13
sp|Q31L23|RS5_SYNE7 30S ribosomal protein S5 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsE PE=3 SV=1 95 242 1.0E-13
sp|P66582|RS5_STRR6 30S ribosomal protein S5 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsE PE=3 SV=1 93 233 1.0E-13
sp|P66581|RS5_STRPN 30S ribosomal protein S5 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsE PE=3 SV=1 93 233 1.0E-13
sp|Q04ML9|RS5_STRP2 30S ribosomal protein S5 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsE PE=3 SV=1 93 233 1.0E-13
sp|C6C1A2|RS5_DESAD 30S ribosomal protein S5 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsE PE=3 SV=1 94 238 1.0E-13
sp|A3CK81|RS5_STRSV 30S ribosomal protein S5 OS=Streptococcus sanguinis (strain SK36) GN=rpsE PE=3 SV=1 93 233 1.0E-13
sp|Q98PZ9|RS5_MYCPU 30S ribosomal protein S5 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsE PE=3 SV=1 96 232 1.0E-13
sp|Q67JW0|RS5_SYMTH 30S ribosomal protein S5 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsE PE=3 SV=1 93 234 1.0E-13
sp|Q211G5|RS5_RHOPB 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsE PE=3 SV=1 96 238 1.0E-13
sp|A5IYW9|RS5_MYCAP 30S ribosomal protein S5 OS=Mycoplasma agalactiae (strain PG2) GN=rpsE PE=3 SV=1 93 252 1.0E-13
sp|B8G6Q8|RS5_CHLAD 30S ribosomal protein S5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsE PE=3 SV=1 88 259 1.0E-13
sp|Q2RQX7|RS5_RHORT 30S ribosomal protein S5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsE PE=3 SV=1 96 239 2.0E-13
sp|C0QQP0|RS5_PERMH 30S ribosomal protein S5 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsE PE=3 SV=1 81 236 2.0E-13
sp|Q07KN5|RS5_RHOP5 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsE PE=3 SV=1 96 238 2.0E-13
sp|A7HWS8|RS5_PARL1 30S ribosomal protein S5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsE PE=3 SV=1 96 238 2.0E-13
sp|Q9X1J2|RS5_THEMA 30S ribosomal protein S5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsE PE=3 SV=1 106 245 2.0E-13
sp|A8IAP6|RS5_AZOC5 30S ribosomal protein S5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsE PE=3 SV=1 88 238 2.0E-13
sp|A0L5Z0|RS5_MAGMM 30S ribosomal protein S5 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsE PE=3 SV=1 84 238 2.0E-13
sp|A7H0Z5|RS5_CAMC5 30S ribosomal protein S5 OS=Campylobacter curvus (strain 525.92) GN=rpsE PE=3 SV=1 93 237 2.0E-13
sp|Q749A4|RS5_GEOSL 30S ribosomal protein S5 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsE PE=3 SV=1 93 233 2.0E-13
sp|A1ALV8|RS5_PELPD 30S ribosomal protein S5 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsE PE=3 SV=1 93 234 2.0E-13
sp|Q0AUJ7|RS5_SYNWW 30S ribosomal protein S5 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsE PE=3 SV=1 92 233 2.0E-13
sp|B8DNB3|RS5_DESVM 30S ribosomal protein S5 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsE PE=3 SV=1 94 238 2.0E-13
sp|Q7M8E9|RS5_WOLSU 30S ribosomal protein S5 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsE PE=3 SV=1 93 237 2.0E-13
sp|Q1AU46|RS5_RUBXD 30S ribosomal protein S5 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsE PE=3 SV=1 93 232 2.0E-13
sp|B9K8A3|RS5_THENN 30S ribosomal protein S5 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsE PE=3 SV=1 106 245 2.0E-13
sp|B8ELE6|RS5_METSB 30S ribosomal protein S5 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsE PE=3 SV=1 93 236 3.0E-13
sp|B1Y8C0|RS5_LEPCP 30S ribosomal protein S5 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsE PE=3 SV=1 90 237 3.0E-13
sp|A7HZM3|RS5_CAMHC 30S ribosomal protein S5 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsE PE=3 SV=1 93 237 3.0E-13
sp|B6JEY2|RS5_OLICO 30S ribosomal protein S5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsE PE=3 SV=1 96 238 4.0E-13
sp|A0LIK7|RS5_SYNFM 30S ribosomal protein S5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsE PE=3 SV=1 93 233 4.0E-13
sp|Q2NIX1|RS5_AYWBP 30S ribosomal protein S5 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsE PE=3 SV=1 94 233 4.0E-13
sp|A0RM28|RS5_CAMFF 30S ribosomal protein S5 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsE PE=3 SV=1 93 241 4.0E-13
sp|A4VSH0|RS5_STRSY 30S ribosomal protein S5 OS=Streptococcus suis (strain 05ZYH33) GN=rpsE PE=3 SV=1 93 233 5.0E-13
sp|A4VYQ9|RS5_STRS2 30S ribosomal protein S5 OS=Streptococcus suis (strain 98HAH33) GN=rpsE PE=3 SV=1 93 233 5.0E-13
sp|A8ESW0|RS5_ARCB4 30S ribosomal protein S5 OS=Arcobacter butzleri (strain RM4018) GN=rpsE PE=3 SV=1 94 241 5.0E-13
sp|B1LWQ9|RS5_METRJ 30S ribosomal protein S5 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsE PE=3 SV=1 96 238 5.0E-13
sp|A8LM74|RS5_DINSH 30S ribosomal protein S5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsE PE=3 SV=1 92 233 5.0E-13
sp|B1Z776|RS5_METPB 30S ribosomal protein S5 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsE PE=3 SV=1 96 238 5.0E-13
sp|A9W4S3|RS5_METEP 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain PA1) GN=rpsE PE=3 SV=1 96 238 5.0E-13
sp|B7L0T3|RS5_METC4 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsE PE=3 SV=1 96 238 5.0E-13
sp|Q3SSU9|RS5_NITWN 30S ribosomal protein S5 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsE PE=3 SV=1 96 238 5.0E-13
sp|A1W325|RS5_ACISJ 30S ribosomal protein S5 OS=Acidovorax sp. (strain JS42) GN=rpsE PE=3 SV=1 94 239 6.0E-13
sp|B9MBV4|RS5_ACIET 30S ribosomal protein S5 OS=Acidovorax ebreus (strain TPSY) GN=rpsE PE=3 SV=1 94 239 6.0E-13
sp|Q1WSA7|RS5_LACS1 30S ribosomal protein S5 OS=Lactobacillus salivarius (strain UCC118) GN=rpsE PE=3 SV=1 94 238 6.0E-13
sp|Q30Z59|RS5_DESAG 30S ribosomal protein S5 OS=Desulfovibrio alaskensis (strain G20) GN=rpsE PE=3 SV=1 94 238 6.0E-13
sp|B4U761|RS5_HYDS0 30S ribosomal protein S5 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpsE PE=3 SV=1 93 236 7.0E-13
sp|B2UV65|RS5_HELPS 30S ribosomal protein S5 OS=Helicobacter pylori (strain Shi470) GN=rpsE PE=3 SV=1 93 237 7.0E-13
sp|Q1CRV8|RS5_HELPH 30S ribosomal protein S5 OS=Helicobacter pylori (strain HPAG1) GN=rpsE PE=3 SV=1 93 237 7.0E-13
sp|B6JNE1|RS5_HELP2 30S ribosomal protein S5 OS=Helicobacter pylori (strain P12) GN=rpsE PE=3 SV=1 93 237 7.0E-13
sp|Q661C5|RS5_BORBP 30S ribosomal protein S5 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsE PE=3 SV=1 96 235 7.0E-13
sp|B2A4F6|RS5_NATTJ 30S ribosomal protein S5 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsE PE=3 SV=1 94 237 7.0E-13
sp|B7KI03|RS5_CYAP7 30S ribosomal protein S5 OS=Cyanothece sp. (strain PCC 7424) GN=rpsE PE=3 SV=1 95 234 7.0E-13
sp|A2C4Y3|RS5_PROM1 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsE PE=3 SV=1 95 237 7.0E-13
sp|Q0RRQ4|RS5_FRAAA 30S ribosomal protein S5 OS=Frankia alni (strain ACN14a) GN=rpsE PE=3 SV=1 96 262 7.0E-13
sp|C5CQ83|RS5_VARPS 30S ribosomal protein S5 OS=Variovorax paradoxus (strain S110) GN=rpsE PE=3 SV=1 94 239 8.0E-13
sp|Q4AAF7|RS5_MYCHJ 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsE PE=3 SV=1 92 236 8.0E-13
sp|Q601J7|RS5_MYCH2 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsE PE=3 SV=1 92 236 8.0E-13
sp|A8LB15|RS5_FRASN 30S ribosomal protein S5 OS=Frankia sp. (strain EAN1pec) GN=rpsE PE=3 SV=1 96 262 8.0E-13
sp|P66572|RS5_HELPY 30S ribosomal protein S5 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsE PE=3 SV=2 93 237 8.0E-13
sp|P66573|RS5_HELPJ 30S ribosomal protein S5 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsE PE=3 SV=2 93 237 8.0E-13
sp|Q2JFF9|RS5_FRASC 30S ribosomal protein S5 OS=Frankia sp. (strain CcI3) GN=rpsE PE=3 SV=1 96 262 8.0E-13
sp|B0JHY7|RS5_MICAN 30S ribosomal protein S5 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsE PE=3 SV=1 95 248 8.0E-13
sp|Q16AC7|RS5_ROSDO 30S ribosomal protein S5 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsE PE=3 SV=1 92 233 9.0E-13
sp|Q4A8I8|RS5_MYCH7 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsE PE=3 SV=1 92 236 9.0E-13
sp|Q74L73|RS5_LACJO 30S ribosomal protein S5 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsE PE=3 SV=1 94 237 9.0E-13
sp|Q046A9|RS5_LACGA 30S ribosomal protein S5 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsE PE=3 SV=1 94 237 9.0E-13
sp|P51298|RR5_PORPU 30S ribosomal protein S5, chloroplastic OS=Porphyra purpurea GN=rps5 PE=3 SV=1 95 248 9.0E-13
sp|Q3AMP6|RS5_SYNSC 30S ribosomal protein S5 OS=Synechococcus sp. (strain CC9605) GN=rpsE PE=3 SV=1 95 237 9.0E-13
sp|Q2S3P7|RS5_SALRD 30S ribosomal protein S5 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsE PE=3 SV=1 96 243 9.0E-13
sp|Q318K0|RS5_PROM9 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsE PE=3 SV=1 95 237 1.0E-12
sp|Q46IS5|RS5_PROMT 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsE PE=3 SV=1 95 237 1.0E-12
sp|Q21QP0|RS5_RHOFT 30S ribosomal protein S5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsE PE=3 SV=1 94 238 1.0E-12
sp|Q5NQ48|RS5_ZYMMO 30S ribosomal protein S5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsE PE=3 SV=1 93 238 1.0E-12
sp|A9BRW8|RS5_DELAS 30S ribosomal protein S5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsE PE=3 SV=1 90 239 1.0E-12
sp|Q7V9X8|RS5_PROMA 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsE PE=3 SV=1 95 237 1.0E-12
sp|C1B029|RS5_RHOOB 30S ribosomal protein S5 OS=Rhodococcus opacus (strain B4) GN=rpsE PE=3 SV=1 96 236 1.0E-12
sp|Q0S3F9|RS5_RHOJR 30S ribosomal protein S5 OS=Rhodococcus jostii (strain RHA1) GN=rpsE PE=3 SV=1 96 236 1.0E-12
sp|A8G745|RS5_PROM2 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9215) GN=rpsE PE=3 SV=1 95 237 1.0E-12
sp|Q0SN12|RS5_BORAP 30S ribosomal protein S5 OS=Borrelia afzelii (strain PKo) GN=rpsE PE=3 SV=1 96 235 1.0E-12
sp|Q3ZZQ7|RS5_DEHMC 30S ribosomal protein S5 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsE PE=3 SV=1 87 233 1.0E-12
sp|Q7V529|RS5_PROMM 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsE PE=3 SV=1 95 237 1.0E-12
sp|B5ELZ6|RS5_ACIF5 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsE PE=3 SV=1 94 235 1.0E-12
sp|B7J484|RS5_ACIF2 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsE PE=3 SV=1 94 235 1.0E-12
sp|Q7U4I4|RS5_SYNPX 30S ribosomal protein S5 OS=Synechococcus sp. (strain WH8102) GN=rpsE PE=3 SV=1 95 237 2.0E-12
sp|A2CC44|RS5_PROM3 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsE PE=3 SV=1 95 237 2.0E-12
sp|A5GIS9|RS5_SYNPW 30S ribosomal protein S5 OS=Synechococcus sp. (strain WH7803) GN=rpsE PE=3 SV=1 95 234 2.0E-12
sp|A1VJ32|RS5_POLNA 30S ribosomal protein S5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsE PE=3 SV=1 94 239 2.0E-12
sp|B2V7J6|RS5_SULSY 30S ribosomal protein S5 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsE PE=3 SV=1 81 236 2.0E-12
sp|P59126|RS5_THEEB 30S ribosomal protein S5 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsE PE=3 SV=1 95 248 2.0E-12
sp|Q1XDJ0|RR5_PYRYE 30S ribosomal protein S5, chloroplastic OS=Pyropia yezoensis GN=rps5 PE=3 SV=1 95 227 2.0E-12
sp|A5GVX6|RS5_SYNR3 30S ribosomal protein S5 OS=Synechococcus sp. (strain RCC307) GN=rpsE PE=3 SV=1 95 234 2.0E-12
sp|Q3Z964|RS5_DEHM1 30S ribosomal protein S5 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsE PE=3 SV=1 87 233 2.0E-12
sp|Q7MTN0|RS5_PORGI 30S ribosomal protein S5 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsE PE=3 SV=1 93 237 2.0E-12
sp|Q17ZC2|RS5_HELAH 30S ribosomal protein S5 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsE PE=3 SV=1 93 237 2.0E-12
sp|Q7UZW0|RS5_PROMP 30S ribosomal protein S5 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpsE PE=3 SV=1 95 237 2.0E-12
sp|B0UHV2|RS5_METS4 30S ribosomal protein S5 OS=Methylobacterium sp. (strain 4-46) GN=rpsE PE=3 SV=1 96 236 2.0E-12
sp|P73304|RS5_SYNY3 30S ribosomal protein S5 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsE PE=3 SV=1 95 248 2.0E-12
sp|Q5Z1Q5|RS5_NOCFA 30S ribosomal protein S5 OS=Nocardia farcinica (strain IFM 10152) GN=rpsE PE=3 SV=1 96 236 3.0E-12
sp|A7IPQ3|RS5_XANP2 30S ribosomal protein S5 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsE PE=3 SV=1 88 238 3.0E-12
sp|Q8YPJ5|RS5_NOSS1 30S ribosomal protein S5 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsE PE=3 SV=1 95 248 3.0E-12
sp|Q3MFA5|RS5_ANAVT 30S ribosomal protein S5 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsE PE=3 SV=1 95 248 3.0E-12
sp|B0K5R0|RS5_THEPX 30S ribosomal protein S5 OS=Thermoanaerobacter sp. (strain X514) GN=rpsE PE=3 SV=1 94 233 3.0E-12
sp|B0KCL7|RS5_THEP3 30S ribosomal protein S5 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsE PE=3 SV=1 94 233 3.0E-12
sp|Q5LW41|RS5_RUEPO 30S ribosomal protein S5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsE PE=3 SV=1 92 233 3.0E-12
sp|Q7VGC7|RS5_HELHP 30S ribosomal protein S5 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsE PE=3 SV=1 93 237 3.0E-12
sp|A3PF31|RS5_PROM0 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsE PE=3 SV=1 95 237 3.0E-12
sp|Q28UT7|RS5_JANSC 30S ribosomal protein S5 OS=Jannaschia sp. (strain CCS1) GN=rpsE PE=3 SV=1 92 238 3.0E-12
sp|Q6B8W9|RR5_GRATL 30S ribosomal protein S5, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rps5 PE=3 SV=1 95 242 3.0E-12
sp|C3MAZ7|RS5_RHISN 30S ribosomal protein S5 OS=Rhizobium sp. (strain NGR234) GN=rpsE PE=3 SV=1 96 238 3.0E-12
sp|Q5HSA7|RS5_CAMJR 30S ribosomal protein S5 OS=Campylobacter jejuni (strain RM1221) GN=rpsE PE=3 SV=1 93 237 3.0E-12
sp|A1W1U3|RS5_CAMJJ 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsE PE=3 SV=1 93 237 3.0E-12
sp|Q9PLY8|RS5_CAMJE 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsE PE=3 SV=1 93 237 3.0E-12
sp|A7H639|RS5_CAMJD 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsE PE=3 SV=1 93 237 3.0E-12
sp|A8FP04|RS5_CAMJ8 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsE PE=3 SV=1 93 237 3.0E-12
sp|Q39XY9|RS5_GEOMG 30S ribosomal protein S5 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsE PE=3 SV=1 93 233 3.0E-12
sp|A1TJT4|RS5_ACIAC 30S ribosomal protein S5 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsE PE=3 SV=1 94 239 3.0E-12
sp|Q3AW77|RS5_SYNS9 30S ribosomal protein S5 OS=Synechococcus sp. (strain CC9902) GN=rpsE PE=3 SV=1 95 238 3.0E-12
sp|A6QCR5|RS5_SULNB 30S ribosomal protein S5 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsE PE=3 SV=1 98 237 3.0E-12
sp|A6MW17|RR5_RHDSA 30S ribosomal protein S5, chloroplastic OS=Rhodomonas salina GN=rps5 PE=3 SV=1 95 234 3.0E-12
sp|A6X0D5|RS5_OCHA4 30S ribosomal protein S5 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsE PE=3 SV=1 96 238 4.0E-12
sp|A0T0Y9|RR5_THAPS 30S ribosomal protein S5, chloroplastic OS=Thalassiosira pseudonana GN=rps5 PE=3 SV=1 93 239 4.0E-12
sp|A2BYS0|RS5_PROM5 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9515) GN=rpsE PE=3 SV=1 95 237 4.0E-12
sp|Q1GK12|RS5_RUEST 30S ribosomal protein S5 OS=Ruegeria sp. (strain TM1040) GN=rpsE PE=3 SV=1 92 233 4.0E-12
sp|Q2W2K8|RS5_MAGSA 30S ribosomal protein S5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsE PE=3 SV=1 96 238 4.0E-12
sp|B2ITN9|RS5_NOSP7 30S ribosomal protein S5 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsE PE=3 SV=1 95 248 4.0E-12
sp|Q03ZM9|RS5_LEUMM 30S ribosomal protein S5 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsE PE=3 SV=1 91 238 5.0E-12
sp|Q488Z6|RS5_COLP3 30S ribosomal protein S5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsE PE=3 SV=1 94 240 5.0E-12
sp|A4YSK9|RS5_BRASO 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsE PE=3 SV=2 96 238 5.0E-12
sp|A5ELL0|RS5_BRASB 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsE PE=3 SV=1 96 238 5.0E-12
sp|A1WK99|RS5_VEREI 30S ribosomal protein S5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsE PE=3 SV=1 90 239 5.0E-12
sp|Q12G86|RS5_POLSJ 30S ribosomal protein S5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsE PE=3 SV=1 94 239 5.0E-12
sp|Q1QN13|RS5_NITHX 30S ribosomal protein S5 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsE PE=3 SV=1 96 238 6.0E-12
sp|A5FZU8|RS5_ACICJ 30S ribosomal protein S5 OS=Acidiphilium cryptum (strain JF-5) GN=rpsE PE=3 SV=1 94 239 6.0E-12
sp|A6U876|RS5_SINMW 30S ribosomal protein S5 OS=Sinorhizobium medicae (strain WSM419) GN=rpsE PE=3 SV=1 96 238 6.0E-12
sp|Q92QF3|RS5_RHIME 30S ribosomal protein S5 OS=Rhizobium meliloti (strain 1021) GN=rpsE PE=3 SV=1 96 238 6.0E-12
sp|Q2S929|RS5_HAHCH 30S ribosomal protein S5 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsE PE=3 SV=1 93 233 6.0E-12
sp|A2BTC1|RS5_PROMS 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain AS9601) GN=rpsE PE=3 SV=1 95 237 7.0E-12
sp|B2IK79|RS5_BEII9 30S ribosomal protein S5 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsE PE=3 SV=1 96 236 7.0E-12
sp|Q0ANR7|RS5_MARMM 30S ribosomal protein S5 OS=Maricaulis maris (strain MCS10) GN=rpsE PE=3 SV=1 93 236 8.0E-12
sp|Q0BYD1|RS5_HYPNA 30S ribosomal protein S5 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsE PE=3 SV=1 88 236 8.0E-12
sp|Q7UN03|RS5_RHOBA 30S ribosomal protein S5 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsE PE=3 SV=1 94 237 8.0E-12
sp|B8ISA2|RS5_METNO 30S ribosomal protein S5 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsE PE=3 SV=1 96 236 9.0E-12
sp|P66571|RS5_BRUSU 30S ribosomal protein S5 OS=Brucella suis biovar 1 (strain 1330) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|B0CH15|RS5_BRUSI 30S ribosomal protein S5 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|P66570|RS5_BRUME 30S ribosomal protein S5 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|C0RJI4|RS5_BRUMB 30S ribosomal protein S5 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|A9M5N3|RS5_BRUC2 30S ribosomal protein S5 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|Q57CS5|RS5_BRUAB 30S ribosomal protein S5 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|Q2YRT3|RS5_BRUA2 30S ribosomal protein S5 OS=Brucella abortus (strain 2308) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|B2S662|RS5_BRUA1 30S ribosomal protein S5 OS=Brucella abortus (strain S19) GN=rpsE PE=3 SV=1 96 238 9.0E-12
sp|B1VAD1|RS5_PHYAS 30S ribosomal protein S5 OS=Phytoplasma australiense GN=rpsE PE=3 SV=1 95 238 9.0E-12
sp|A6LLN0|RS5_THEM4 30S ribosomal protein S5 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsE PE=3 SV=1 94 268 1.0E-11
sp|A0QSG6|RS5_MYCS2 30S ribosomal protein S5 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsE PE=1 SV=1 96 236 1.0E-11
sp|Q1IX89|RS5_DEIGD 30S ribosomal protein S5 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsE PE=3 SV=1 93 238 1.0E-11
sp|Q134U6|RS5_RHOPS 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsE PE=3 SV=1 96 238 1.0E-11
sp|Q2IXP3|RS5_RHOP2 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsE PE=3 SV=1 96 239 1.0E-11
sp|B7K232|RS5_CYAP8 30S ribosomal protein S5 OS=Cyanothece sp. (strain PCC 8801) GN=rpsE PE=3 SV=1 95 248 1.0E-11
sp|A1USR1|RS5_BARBK 30S ribosomal protein S5 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsE PE=3 SV=1 96 236 1.0E-11
sp|Q8UE35|RS5_AGRFC 30S ribosomal protein S5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsE PE=3 SV=1 96 238 1.0E-11
sp|Q85FU7|RR5_CYAME 30S ribosomal protein S5, chloroplastic OS=Cyanidioschyzon merolae GN=rps5 PE=3 SV=1 95 234 1.0E-11
sp|Q47LL0|RS5_THEFY 30S ribosomal protein S5 OS=Thermobifida fusca (strain YX) GN=rpsE PE=3 SV=1 96 238 1.0E-11
sp|B2HCT8|RS5_MYCMM 30S ribosomal protein S5 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsE PE=3 SV=1 96 236 1.0E-11
sp|B4R8N4|RS5_PHEZH 30S ribosomal protein S5 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsE PE=3 SV=1 93 236 2.0E-11
sp|Q30TU7|RS5_SULDN 30S ribosomal protein S5 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsE PE=3 SV=1 94 222 2.0E-11
sp|A5VQY9|RS5_BRUO2 30S ribosomal protein S5 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsE PE=3 SV=1 96 238 2.0E-11
sp|Q1QDG9|RS5_PSYCK 30S ribosomal protein S5 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsE PE=3 SV=1 94 233 2.0E-11
sp|Q4FUD9|RS5_PSYA2 30S ribosomal protein S5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsE PE=3 SV=1 94 233 2.0E-11
sp|Q824N5|RS5_CHLCV 30S ribosomal protein S5 OS=Chlamydophila caviae (strain GPIC) GN=rpsE PE=3 SV=1 93 236 2.0E-11
sp|A1R8S9|RS5_ARTAT 30S ribosomal protein S5 OS=Arthrobacter aurescens (strain TC1) GN=rpsE PE=3 SV=1 93 236 2.0E-11
sp|Q6FZD9|RS5_BARQU 30S ribosomal protein S5 OS=Bartonella quintana (strain Toulouse) GN=rpsE PE=3 SV=1 96 238 2.0E-11
sp|A0PM82|RS5_MYCUA 30S ribosomal protein S5 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsE PE=3 SV=1 96 236 2.0E-11
sp|Q7VKF0|RS5_HAEDU 30S ribosomal protein S5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsE PE=3 SV=1 93 238 3.0E-11
sp|Q89JA1|RS5_BRADU 30S ribosomal protein S5 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsE PE=3 SV=1 96 238 3.0E-11
sp|A9H3L2|RS5_GLUDA 30S ribosomal protein S5 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsE PE=3 SV=1 94 236 3.0E-11
sp|B1WQS7|RS5_CYAA5 30S ribosomal protein S5 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsE PE=3 SV=1 95 248 3.0E-11
sp|C0ZW43|RS5_RHOE4 30S ribosomal protein S5 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsE PE=3 SV=1 93 236 3.0E-11
sp|O33000|RS5_MYCLE 30S ribosomal protein S5 OS=Mycobacterium leprae (strain TN) GN=rpsE PE=3 SV=1 96 236 3.0E-11
sp|B8ZSA2|RS5_MYCLB 30S ribosomal protein S5 OS=Mycobacterium leprae (strain Br4923) GN=rpsE PE=3 SV=1 96 236 3.0E-11
sp|B7VLE0|RS5_VIBTL 30S ribosomal protein S5 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsE PE=3 SV=1 94 239 3.0E-11
sp|Q9Z7S3|RS5_CHLPN 30S ribosomal protein S5 OS=Chlamydia pneumoniae GN=rpsE PE=3 SV=1 93 237 3.0E-11
sp|Q9A8T6|RS5_CAUCR 30S ribosomal protein S5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsE PE=3 SV=1 94 236 3.0E-11
sp|B8H4F1|RS5_CAUCN 30S ribosomal protein S5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsE PE=3 SV=1 94 236 3.0E-11
sp|A9IW04|RS5_BART1 30S ribosomal protein S5 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsE PE=3 SV=1 96 238 3.0E-11
sp|A4WVJ1|RS5_RHOS5 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsE PE=3 SV=1 92 233 3.0E-11
sp|Q9RSL1|RS5_DEIRA 30S ribosomal protein S5 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsE PE=3 SV=1 93 255 3.0E-11
sp|B9JVQ4|RS5_AGRVS 30S ribosomal protein S5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsE PE=3 SV=1 96 238 3.0E-11
sp|P0A4C8|RS5_CHLTR 30S ribosomal protein S5 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsE PE=3 SV=1 93 236 4.0E-11
sp|Q3KLI5|RS5_CHLTA 30S ribosomal protein S5 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsE PE=3 SV=1 93 236 4.0E-11
sp|P0A4C9|RS5_CHLMU 30S ribosomal protein S5 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsE PE=3 SV=1 93 236 4.0E-11
sp|Q0VSI6|RS5_ALCBS 30S ribosomal protein S5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsE PE=3 SV=1 94 233 4.0E-11
sp|B9KLA8|RS5_RHOSK 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsE PE=3 SV=1 92 233 4.0E-11
sp|Q3J5Q5|RS5_RHOS4 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsE PE=3 SV=1 92 233 4.0E-11
sp|A3PGM8|RS5_RHOS1 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsE PE=3 SV=1 92 233 4.0E-11
sp|Q3IJK2|RS5_PSEHT 30S ribosomal protein S5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsE PE=3 SV=1 92 238 4.0E-11
sp|B7IHW3|RS5_THEAB 30S ribosomal protein S5 OS=Thermosipho africanus (strain TCF52B) GN=rpsE PE=3 SV=1 94 223 4.0E-11
sp|C3LRP1|RS5_VIBCM 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsE PE=3 SV=1 94 239 4.0E-11
sp|Q9KP01|RS5_VIBCH 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsE PE=3 SV=1 94 239 4.0E-11
sp|A5F563|RS5_VIBC3 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsE PE=3 SV=1 94 239 4.0E-11
sp|Q5FU00|RS5_GLUOX 30S ribosomal protein S5 OS=Gluconobacter oxydans (strain 621H) GN=rpsE PE=3 SV=1 94 236 4.0E-11
sp|B3QBW3|RS5_RHOPT 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsE PE=3 SV=1 96 238 5.0E-11
sp|Q6N4V0|RS5_RHOPA 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsE PE=1 SV=3 96 238 5.0E-11
sp|A2SLE0|RS5_METPP 30S ribosomal protein S5 OS=Methylibium petroleiphilum (strain PM1) GN=rpsE PE=3 SV=1 94 236 5.0E-11
sp|A3N374|RS5_ACTP2 30S ribosomal protein S5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsE PE=3 SV=1 93 238 5.0E-11
sp|B1MGC5|RS5_MYCA9 30S ribosomal protein S5 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpsE PE=3 SV=1 96 236 5.0E-11
sp|A0JZ68|RS5_ARTS2 30S ribosomal protein S5 OS=Arthrobacter sp. (strain FB24) GN=rpsE PE=3 SV=1 93 236 5.0E-11
sp|Q6AD11|RS5_LEIXX 30S ribosomal protein S5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsE PE=3 SV=1 93 236 5.0E-11
sp|A4TED4|RS5_MYCGI 30S ribosomal protein S5 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpsE PE=3 SV=1 96 236 6.0E-11
sp|C1CXE9|RS5_DEIDV 30S ribosomal protein S5 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsE PE=3 SV=1 93 255 6.0E-11
sp|B0UX31|RS5_HISS2 30S ribosomal protein S5 OS=Histophilus somni (strain 2336) GN=rpsE PE=3 SV=1 93 238 6.0E-11
sp|Q0I145|RS5_HAES1 30S ribosomal protein S5 OS=Haemophilus somnus (strain 129Pt) GN=rpsE PE=3 SV=1 93 238 6.0E-11
sp|Q98N40|RS5_RHILO 30S ribosomal protein S5 OS=Rhizobium loti (strain MAFF303099) GN=rpsE PE=3 SV=2 94 238 6.0E-11
sp|Q73PL5|RS5_TREDE 30S ribosomal protein S5 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsE PE=3 SV=1 96 237 6.0E-11
sp|A1S235|RS5_SHEAM 30S ribosomal protein S5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsE PE=3 SV=1 94 238 6.0E-11
sp|Q8R7X1|RS5_CALS4 30S ribosomal protein S5 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsE PE=3 SV=1 87 233 6.0E-11
sp|Q4A5D8|RS5_MYCS5 30S ribosomal protein S5 OS=Mycoplasma synoviae (strain 53) GN=rpsE PE=3 SV=2 90 238 7.0E-11
sp|B2UEK2|RS5_RALPJ 30S ribosomal protein S5 OS=Ralstonia pickettii (strain 12J) GN=rpsE PE=3 SV=1 94 233 7.0E-11
sp|A5WCK7|RS5_PSYWF 30S ribosomal protein S5 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsE PE=3 SV=1 94 233 8.0E-11
sp|Q9CL47|RS5_PASMU 30S ribosomal protein S5 OS=Pasteurella multocida (strain Pm70) GN=rpsE PE=3 SV=1 93 238 8.0E-11
sp|Q1MIC4|RS5_RHIL3 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsE PE=3 SV=1 96 238 8.0E-11
sp|B0T2D9|RS5_CAUSK 30S ribosomal protein S5 OS=Caulobacter sp. (strain K31) GN=rpsE PE=3 SV=1 96 236 8.0E-11
sp|B5ZYV2|RS5_RHILW 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsE PE=3 SV=1 96 238 8.0E-11
sp|Q2K9J9|RS5_RHIEC 30S ribosomal protein S5 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsE PE=3 SV=1 96 238 8.0E-11
sp|B3PWT8|RS5_RHIE6 30S ribosomal protein S5 OS=Rhizobium etli (strain CIAT 652) GN=rpsE PE=3 SV=1 96 238 8.0E-11
sp|A9KWB9|RS5_SHEB9 30S ribosomal protein S5 OS=Shewanella baltica (strain OS195) GN=rpsE PE=3 SV=1 94 236 8.0E-11
sp|A6WHU5|RS5_SHEB8 30S ribosomal protein S5 OS=Shewanella baltica (strain OS185) GN=rpsE PE=3 SV=1 94 236 8.0E-11
sp|A3DA55|RS5_SHEB5 30S ribosomal protein S5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsE PE=3 SV=1 94 236 8.0E-11
sp|B8EBI8|RS5_SHEB2 30S ribosomal protein S5 OS=Shewanella baltica (strain OS223) GN=rpsE PE=3 SV=1 94 236 8.0E-11
sp|A1B044|RS5_PARDP 30S ribosomal protein S5 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsE PE=3 SV=1 92 233 8.0E-11
sp|Q7MPH1|RS5_VIBVY 30S ribosomal protein S5 OS=Vibrio vulnificus (strain YJ016) GN=rpsE PE=3 SV=1 94 239 9.0E-11
sp|Q8DE57|RS5_VIBVU 30S ribosomal protein S5 OS=Vibrio vulnificus (strain CMCP6) GN=rpsE PE=3 SV=1 94 239 9.0E-11
sp|Q04BZ8|RS5_LACDB 30S ribosomal protein S5 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsE PE=3 SV=1 94 233 9.0E-11
sp|Q1GBK1|RS5_LACDA 30S ribosomal protein S5 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsE PE=3 SV=1 94 233 9.0E-11
sp|A4XZ73|RS5_PSEMY 30S ribosomal protein S5 OS=Pseudomonas mendocina (strain ymp) GN=rpsE PE=3 SV=1 96 233 1.0E-10
sp|Q5L704|RS5_CHLAB 30S ribosomal protein S5 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsE PE=3 SV=1 93 236 1.0E-10
sp|Q1LTC1|RS5_BAUCH 30S ribosomal protein S5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsE PE=3 SV=1 83 237 1.0E-10
sp|Q0I088|RS5_SHESR 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-7) GN=rpsE PE=3 SV=1 94 236 1.0E-10
sp|Q0HNS0|RS5_SHESM 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-4) GN=rpsE PE=3 SV=1 94 236 1.0E-10
sp|A0KRP1|RS5_SHESA 30S ribosomal protein S5 OS=Shewanella sp. (strain ANA-3) GN=rpsE PE=3 SV=1 94 236 1.0E-10
sp|P59124|RS5_SHEON 30S ribosomal protein S5 OS=Shewanella oneidensis (strain MR-1) GN=rpsE PE=3 SV=1 94 236 1.0E-10
sp|Q9HWF2|RS5_PSEAE 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsE PE=3 SV=1 96 238 1.0E-10
sp|Q02T63|RS5_PSEAB 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsE PE=3 SV=1 96 238 1.0E-10
sp|B7V661|RS5_PSEA8 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsE PE=3 SV=1 96 238 1.0E-10
sp|A6UZK5|RS5_PSEA7 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsE PE=3 SV=1 96 238 1.0E-10
sp|A0LRN7|RS5_ACIC1 30S ribosomal protein S5 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpsE PE=3 SV=1 96 262 1.0E-10
sp|C1DKN0|RS5_AZOVD 30S ribosomal protein S5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsE PE=3 SV=1 96 233 1.0E-10
sp|P9WH33|RS5_MYCTU 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsE PE=1 SV=1 96 236 1.0E-10
sp|P9WH32|RS5_MYCTO 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsE PE=3 SV=1 96 236 1.0E-10
sp|A5U0A7|RS5_MYCTA 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsE PE=3 SV=1 96 236 1.0E-10
sp|C1AL55|RS5_MYCBT 30S ribosomal protein S5 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsE PE=3 SV=1 96 236 1.0E-10
sp|A1KGK2|RS5_MYCBP 30S ribosomal protein S5 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsE PE=3 SV=1 96 236 1.0E-10
sp|P66575|RS5_MYCBO 30S ribosomal protein S5 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsE PE=3 SV=1 96 236 1.0E-10
sp|P59122|RS5_BIFLO 30S ribosomal protein S5 OS=Bifidobacterium longum (strain NCC 2705) GN=rpsE PE=3 SV=1 93 236 1.0E-10
sp|Q6G2Y2|RS5_BARHE 30S ribosomal protein S5 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsE PE=3 SV=1 82 236 1.0E-10
sp|Q2SU44|RS5_BURTA 30S ribosomal protein S5 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsE PE=3 SV=1 94 233 1.0E-10
sp|B4RT45|RS5_ALTMD 30S ribosomal protein S5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsE PE=3 SV=1 90 237 1.0E-10
sp|Q089N7|RS5_SHEFN 30S ribosomal protein S5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsE PE=3 SV=1 94 236 1.0E-10
sp|Q12SU2|RS5_SHEDO 30S ribosomal protein S5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsE PE=3 SV=1 94 236 1.0E-10
sp|Q89A82|RS5_BUCBP 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsE PE=3 SV=2 94 260 1.0E-10
sp|Q73S92|RS5_MYCPA 30S ribosomal protein S5 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsE PE=3 SV=1 96 236 1.0E-10
sp|A1TYL4|RS5_MARHV 30S ribosomal protein S5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsE PE=3 SV=1 92 233 1.0E-10
sp|Q31IW5|RS5_THICR 30S ribosomal protein S5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsE PE=3 SV=1 94 252 1.0E-10
sp|A1RED1|RS5_SHESW 30S ribosomal protein S5 OS=Shewanella sp. (strain W3-18-1) GN=rpsE PE=3 SV=1 94 236 2.0E-10
sp|A4YBW6|RS5_SHEPC 30S ribosomal protein S5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsE PE=3 SV=1 94 236 2.0E-10
sp|B8DW30|RS5_BIFA0 30S ribosomal protein S5 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpsE PE=3 SV=1 93 236 2.0E-10
sp|Q1R0F8|RS5_CHRSD 30S ribosomal protein S5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|Q0BUN3|RS5_GRABC 30S ribosomal protein S5 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsE PE=3 SV=1 96 236 2.0E-10
sp|B7GNC3|RS5_BIFLS 30S ribosomal protein S5 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpsE PE=3 SV=1 93 236 2.0E-10
sp|B3DQD1|RS5_BIFLD 30S ribosomal protein S5 OS=Bifidobacterium longum (strain DJO10A) GN=rpsE PE=3 SV=1 93 236 2.0E-10
sp|P44374|RS5_HAEIN 30S ribosomal protein S5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsE PE=3 SV=1 93 238 2.0E-10
sp|A5UHU8|RS5_HAEIG 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittGG) GN=rpsE PE=3 SV=1 93 238 2.0E-10
sp|A5UDT0|RS5_HAEIE 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittEE) GN=rpsE PE=3 SV=1 93 238 2.0E-10
sp|Q4QMA4|RS5_HAEI8 30S ribosomal protein S5 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsE PE=3 SV=1 93 238 2.0E-10
sp|B2JI48|RS5_BURP8 30S ribosomal protein S5 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A0KF38|RS5_AERHH 30S ribosomal protein S5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsE PE=3 SV=1 87 236 2.0E-10
sp|Q83EQ9|RS5_COXBU 30S ribosomal protein S5 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|Q63Q28|RS5_BURPS 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain K96243) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A3NEG2|RS5_BURP6 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 668) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|Q3JMT0|RS5_BURP1 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A3P096|RS5_BURP0 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A1V886|RS5_BURMS 30S ribosomal protein S5 OS=Burkholderia mallei (strain SAVP1) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|Q62GM2|RS5_BURMA 30S ribosomal protein S5 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A2S7J3|RS5_BURM9 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A3MRX1|RS5_BURM7 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A9ADL0|RS5_BURM1 30S ribosomal protein S5 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsE PE=3 SV=1 94 233 2.0E-10
sp|A1SNK1|RS5_NOCSJ 30S ribosomal protein S5 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpsE PE=3 SV=1 96 236 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0003676 nucleic acid binding No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0009987 cellular process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006518 peptide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5041
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3102 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4481
Ophiocordyceps camponoti-floridani Ophcf2|03324
Ophiocordyceps kimflemingae Ophio5|5319
Ophiocordyceps subramaniannii Hirsu2|2620

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3102
MADRGRGGGAGDRGGRGGGFGARGGDRGRGGDRGRGRGRGRGRRGGKSEEKEWQPVTKLGRLVKAGKIGSMEEIY
LHSLPIKEYQIVDTFLPKLKDEVMKIKPVQKQTRAGQRTRFKAVVIIGDSEGHVGLGIKTSKEVATAIRAAIIIA
KLSVIPVRRGYWGTNLGSPHSLPCKQSGKCGSVTVRLIPAPRGTGLVASPAVKRFLQLAGVEDAYTSSAGSTKTL
ENTLKATFAAVSNTYGFLTPNLWKETRLLRSPLEEFADTLREGKRY*
Coding >OphauG2|3102
ATGGCTGATCGTGGCCGTGGCGGCGGTGCTGGCGACCGTGGAGGTCGTGGTGGTGGTTTTGGAGCTCGTGGCGGT
GATCGAGGCCGTGGCGGTGACCGTGGTCGTGGTCGTGGCCGGGGCCGTGGGCGTCGCGGCGGCAAGAGTGAGGAG
AAGGAGTGGCAGCCCGTTACCAAGCTTGGCCGACTGGTCAAGGCTGGCAAGATTGGCAGCATGGAGGAAATCTAC
CTACACTCGCTTCCAATCAAGGAGTACCAGATTGTCGACACCTTTCTGCCAAAGCTCAAGGATGAGGTGATGAAG
ATCAAGCCTGTTCAGAAGCAGACGCGCGCCGGTCAGCGGACGCGATTCAAGGCCGTCGTCATTATTGGCGACTCT
GAGGGCCACGTCGGTCTTGGCATCAAGACGTCCAAAGAAGTTGCAACTGCTATCCGGGCCGCCATCATCATTGCC
AAGTTGAGCGTCATTCCCGTCCGCCGAGGCTACTGGGGCACCAACCTCGGTTCACCTCACTCGCTCCCCTGCAAG
CAGAGCGGCAAGTGCGGTTCTGTCACTGTCCGACTTATCCCTGCTCCGCGCGGTACCGGCCTCGTCGCCTCTCCT
GCTGTCAAGCGCTTCCTTCAGCTCGCTGGTGTCGAAGACGCCTACACGTCATCGGCCGGATCCACCAAGACTCTG
GAAAACACTCTCAAGGCGACATTTGCGGCCGTCTCCAACACATATGGCTTCCTGACGCCCAACTTGTGGAAAGAA
ACTAGGCTGCTCCGAAGTCCCTTGGAGGAGTTTGCAGATACTCTGCGCGAGGGCAAGCGGTACTAG
Transcript >OphauG2|3102
ATGGCTGATCGTGGCCGTGGCGGCGGTGCTGGCGACCGTGGAGGTCGTGGTGGTGGTTTTGGAGCTCGTGGCGGT
GATCGAGGCCGTGGCGGTGACCGTGGTCGTGGTCGTGGCCGGGGCCGTGGGCGTCGCGGCGGCAAGAGTGAGGAG
AAGGAGTGGCAGCCCGTTACCAAGCTTGGCCGACTGGTCAAGGCTGGCAAGATTGGCAGCATGGAGGAAATCTAC
CTACACTCGCTTCCAATCAAGGAGTACCAGATTGTCGACACCTTTCTGCCAAAGCTCAAGGATGAGGTGATGAAG
ATCAAGCCTGTTCAGAAGCAGACGCGCGCCGGTCAGCGGACGCGATTCAAGGCCGTCGTCATTATTGGCGACTCT
GAGGGCCACGTCGGTCTTGGCATCAAGACGTCCAAAGAAGTTGCAACTGCTATCCGGGCCGCCATCATCATTGCC
AAGTTGAGCGTCATTCCCGTCCGCCGAGGCTACTGGGGCACCAACCTCGGTTCACCTCACTCGCTCCCCTGCAAG
CAGAGCGGCAAGTGCGGTTCTGTCACTGTCCGACTTATCCCTGCTCCGCGCGGTACCGGCCTCGTCGCCTCTCCT
GCTGTCAAGCGCTTCCTTCAGCTCGCTGGTGTCGAAGACGCCTACACGTCATCGGCCGGATCCACCAAGACTCTG
GAAAACACTCTCAAGGCGACATTTGCGGCCGTCTCCAACACATATGGCTTCCTGACGCCCAACTTGTGGAAAGAA
ACTAGGCTGCTCCGAAGTCCCTTGGAGGAGTTTGCAGATACTCTGCGCGAGGGCAAGCGGTACTAG
Gene >OphauG2|3102
ATGGCTGATCGTGGCCGTGGCGGCGGTGCTGGCGACCGTGGAGGTCGTGGTGGTGGTTTTGGAGCTCGTGGCGGT
GATCGAGGCCGTGGCGGTGACCGTGGTCGTGGTCGTGGCCGGGGCCGTGGGCGTCGCGGCGGCAAGAGTGAGGAG
AAGGAGTGGCAGCCCGTTACCAAGCTTGGCCGACTGGTCAAGGCTGGCAAGATTGGCAGCATGGAGGAAATCTAC
CTACACTCGCTTCCAATCAAGGAGTACCAGATTGTCGACACCTTTCTGCCAAAGCTCAAGGATGAGGTGATGAAG
GTATGCAACAACCTCAATTGTGGCTCTCGGGTCACGTCGTGTACCGTCTCGATTGCGTACAAGGAGATGGCGTGC
GCAGATGCGACAACCAATACACGAGAGACTCGAGTTGCTAACGCGGCCTTTGTTTTGCCTCGATACAGATCAAGC
CTGTTCAGAAGCAGACGCGCGCCGGTCAGCGGACGCGATTCAAGGCCGTCGTCATTATTGGCGACTCTGAGGGCC
ACGTCGGTCTTGGCATCAAGACGTCCAAAGAAGTTGCAACTGCTATCCGGGCCGCCATCATCATTGCCAAGTTGA
GCGTCATTCCCGTCCGCCGAGGCTACTGGGGCACCAACCTCGGTTCACCTCACTCGCTCCCCTGCAAGCAGAGCG
GCAAGTGCGGTTCTGTCACTGTCCGAGTATGTGTCCTCCTGATAACGAGTGCTGGCTGTCGTGGCCGAGTGTATG
AGTGGATCTATCAAAAGGCTGACATTCTTCCCTTGTACACAGCTTATCCCTGCTCCGCGCGGTACCGGCCTCGTC
GCCTCTCCTGCTGTCAAGCGCTTCCTTCAGCTCGCTGGTGTCGAAGACGCCTACACGTCATCGGCCGGATCCACC
AAGACTCTGGAAAACACTCTCAAGGCGACATTTGCGGCCGTCTCCAACACATATGGCTTCCTGACGCCCAACTTG
TGGAAAGAAACTAGGCTGCTCCGAAGTCCCTTGGAGGAGTTTGCAGATACTCTGCGCGAGGGCAAGCGGTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail