Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3095
Gene name
LocationContig_228:271..1181
Strand+
Gene length (bp)910
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 7.9E-08 81 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SGS1|CSN7A_NEUCR COP9 signalosome complex subunit 7a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-7a PE=1 SV=1 1 217 4.0E-64
sp|Q00648|CSN7_EMENI COP9 signalosome complex subunit 7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnG PE=1 SV=1 1 219 2.0E-47
sp|Q9CZ04|CSN7A_MOUSE COP9 signalosome complex subunit 7a OS=Mus musculus GN=Cops7a PE=1 SV=2 11 223 3.0E-29
sp|Q5R762|CSN7A_PONAB COP9 signalosome complex subunit 7a OS=Pongo abelii GN=COPS7A PE=2 SV=1 11 223 1.0E-28
sp|Q9UBW8|CSN7A_HUMAN COP9 signalosome complex subunit 7a OS=Homo sapiens GN=COPS7A PE=1 SV=1 11 223 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SGS1|CSN7A_NEUCR COP9 signalosome complex subunit 7a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-7a PE=1 SV=1 1 217 4.0E-64
sp|Q00648|CSN7_EMENI COP9 signalosome complex subunit 7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnG PE=1 SV=1 1 219 2.0E-47
sp|Q9CZ04|CSN7A_MOUSE COP9 signalosome complex subunit 7a OS=Mus musculus GN=Cops7a PE=1 SV=2 11 223 3.0E-29
sp|Q5R762|CSN7A_PONAB COP9 signalosome complex subunit 7a OS=Pongo abelii GN=COPS7A PE=2 SV=1 11 223 1.0E-28
sp|Q9UBW8|CSN7A_HUMAN COP9 signalosome complex subunit 7a OS=Homo sapiens GN=COPS7A PE=1 SV=1 11 223 1.0E-28
sp|Q9H9Q2|CSN7B_HUMAN COP9 signalosome complex subunit 7b OS=Homo sapiens GN=COPS7B PE=1 SV=1 2 192 9.0E-28
sp|Q2KI56|CSN7B_BOVIN COP9 signalosome complex subunit 7b OS=Bos taurus GN=COPS7B PE=2 SV=1 2 192 9.0E-28
sp|Q8BV13|CSN7B_MOUSE COP9 signalosome complex subunit 7b OS=Mus musculus GN=Cops7b PE=1 SV=1 2 192 1.0E-27
sp|Q55BD5|CSN7_DICDI COP9 signalosome complex subunit 7 OS=Dictyostelium discoideum GN=csn7 PE=1 SV=1 8 201 1.0E-25
sp|Q9V4S8|CSN7_DROME COP9 signalosome complex subunit 7 OS=Drosophila melanogaster GN=CSN7 PE=1 SV=2 10 204 2.0E-25
sp|Q94JU3|CSN7_ARATH COP9 signalosome complex subunit 7 OS=Arabidopsis thaliana GN=CSN7 PE=1 SV=1 25 229 2.0E-22
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5887
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3095 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4488
Ophiocordyceps camponoti-floridani Ophcf2|03317
Ophiocordyceps camponoti-rufipedis Ophun1|4631
Ophiocordyceps kimflemingae Ophio5|5312

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3095
MEQIKALNALESFVALSKAATSPRAAAELVTRATSAPNTFVFAELLQTPQIQALANSPEHASHLALLRIFSYGTY
ASYKSDATLPALNDAQEQKLRKLSLLTLARDCKELSYHQLQKSLALDSTRLVEGVVISCIYDGLLHATLDPQQQV
VHVTSISPLRDVEPGAVPDMITALDEWAARCSSTIADIESQITSIRSVAAQRSKDAAAANDKLEKLMAEVRDTDP
LRSDQVNTQALARRGLNKRAILESDPVDHQDKMDLDDPLYLDEQSKRASKRKM*
Coding >OphauG2|3095
ATGGAGCAGATCAAGGCGCTCAATGCTCTCGAGTCCTTTGTCGCCCTCTCCAAGGCGGCAACCTCGCCCCGCGCT
GCCGCAGAGCTCGTTACCCGCGCAACCTCGGCCCCAAACACGTTTGTCTTTGCCGAACTTCTTCAAACACCCCAG
ATTCAGGCTCTGGCCAACAGCCCCGAGCACGCCTCCCATCTCGCTCTGCTTCGCATCTTCTCCTATGGCACCTAC
GCCTCGTACAAGAGCGATGCTACCTTGCCTGCTCTCAACGACGCCCAGGAACAAAAACTTCGCAAGCTCTCTCTT
CTCACCCTTGCCCGCGACTGCAAAGAGCTCTCATACCATCAACTTCAAAAATCCCTCGCACTCGACTCTACTCGT
CTGGTAGAAGGCGTAGTCATCTCTTGCATCTACGATGGCCTGCTCCACGCCACCCTCGACCCTCAGCAACAAGTC
GTACACGTCACCTCCATCTCGCCACTTCGTGATGTTGAGCCTGGCGCTGTTCCAGACATGATTACAGCTCTCGAC
GAATGGGCCGCCCGTTGTTCTTCTACCATTGCCGACATTGAGTCTCAAATTACCTCGATTCGCTCAGTAGCCGCT
CAACGCTCCAAAGACGCGGCCGCCGCCAATGACAAGCTTGAAAAACTCATGGCAGAGGTGCGCGATACTGACCCT
CTGAGATCAGACCAAGTAAACACTCAGGCTCTGGCTCGACGAGGCCTTAACAAGCGAGCAATCCTCGAGTCGGAC
CCTGTTGACCACCAAGATAAAATGGACCTTGATGATCCCTTATACCTTGACGAGCAGTCCAAGAGGGCAAGCAAA
CGCAAGATGTGA
Transcript >OphauG2|3095
ATGGAGCAGATCAAGGCGCTCAATGCTCTCGAGTCCTTTGTCGCCCTCTCCAAGGCGGCAACCTCGCCCCGCGCT
GCCGCAGAGCTCGTTACCCGCGCAACCTCGGCCCCAAACACGTTTGTCTTTGCCGAACTTCTTCAAACACCCCAG
ATTCAGGCTCTGGCCAACAGCCCCGAGCACGCCTCCCATCTCGCTCTGCTTCGCATCTTCTCCTATGGCACCTAC
GCCTCGTACAAGAGCGATGCTACCTTGCCTGCTCTCAACGACGCCCAGGAACAAAAACTTCGCAAGCTCTCTCTT
CTCACCCTTGCCCGCGACTGCAAAGAGCTCTCATACCATCAACTTCAAAAATCCCTCGCACTCGACTCTACTCGT
CTGGTAGAAGGCGTAGTCATCTCTTGCATCTACGATGGCCTGCTCCACGCCACCCTCGACCCTCAGCAACAAGTC
GTACACGTCACCTCCATCTCGCCACTTCGTGATGTTGAGCCTGGCGCTGTTCCAGACATGATTACAGCTCTCGAC
GAATGGGCCGCCCGTTGTTCTTCTACCATTGCCGACATTGAGTCTCAAATTACCTCGATTCGCTCAGTAGCCGCT
CAACGCTCCAAAGACGCGGCCGCCGCCAATGACAAGCTTGAAAAACTCATGGCAGAGGTGCGCGATACTGACCCT
CTGAGATCAGACCAAGTAAACACTCAGGCTCTGGCTCGACGAGGCCTTAACAAGCGAGCAATCCTCGAGTCGGAC
CCTGTTGACCACCAAGATAAAATGGACCTTGATGATCCCTTATACCTTGACGAGCAGTCCAAGAGGGCAAGCAAA
CGCAAGATGTGA
Gene >OphauG2|3095
ATGGAGCAGATCAAGGCGCTCAATGCTCTCGAGGTACTCCCTTGTTCTCCCCGCAACACAATGTCCCTGCCAATC
TGGCCCTAGCTCATCAGACTCTGTCTTCAAGTCCTTTGTCGCCCTCTCCAAGGCGGCAACCTCGCCCCGCGCTGC
CGCAGAGCTCGTTACCCGCGCAACCTCGGCCCCAAACACGTTTGTCTTTGCCGAACTTCTTCAAACACCCCAGAT
TCAGGCTCTGGCCAACAGCCCCGAGCACGCCTCCCATCTCGCTCTGCTTCGCATCTTCTCCTATGGCACCTACGC
CTCGTACAAGAGCGATGCTACCTTGCCTGCTCTCAACGACGCCCAGGAACAAAAACTTCGCAAGCTCTCTCTTCT
CACCCTTGCCCGCGACTGCAAAGAGCTCTCATACCATCAACTTCAAAAATCCCTCGCACTCGACTCTACTCGTCT
GGTAGAAGGCGTAGTCATCTCTTGCATCTACGATGGCCTGCTCCACGCCACCCTCGACCCTCAGCAACAAGTCGT
ACACGTCACCTCCATCTCGCCACTTCGTGATGTTGAGCCTGGCGCTGTTCCAGACATGATTACAGCTCTCGACGA
ATGGGCCGCCCGTTGTTCTTCTACCATTGCCGACATTGAGTCTCAAATTACCTCGATTCGCTCAGTAGCCGCTCA
ACGCTCCAAAGACGCGGCCGCCGCCAATGACAAGCTTGAAAAACTCATGGCAGAGGTGCGCGATACTGACCCTCT
GAGATCAGACCAAGTAAACACTCAGGCTCTGGCTCGACGAGGCCTTAACAAGCGAGCAATCCTCGAGTCGGACCC
TGTTGACCACCAAGATAAAATGGACCTTGATGATCCCTTATACCTTGACGAGCAGTCCAAGAGGGCAAGCAAACG
CAAGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail