Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3086
Gene name
LocationContig_227:9156..10720
Strand+
Gene length (bp)1564
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04406 TP6A_N Type IIB DNA topoisomerase 3.8E-21 73 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40384|REC12_SCHPO Meiotic recombination protein rec12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec12 PE=1 SV=2 25 278 1.0E-35
sp|Q5ZPI9|SPO12_ORYSI Meiotic recombination protein SPO11-2 OS=Oryza sativa subsp. indica GN=SPO11-2 PE=1 SV=1 71 285 1.0E-35
sp|Q6ZD95|SPO12_ORYSJ Meiotic recombination protein SPO11-2 OS=Oryza sativa subsp. japonica GN=SPO11-2 PE=2 SV=1 71 285 1.0E-35
sp|Q0DSV9|TOP6A_ORYSJ Topoisomerase 6 subunit A3 OS=Oryza sativa subsp. japonica GN=SPO11-3 PE=2 SV=2 3 284 7.0E-34
sp|A2XFC1|TOP6A_ORYSI DNA topoisomerase 6 subunit A3 OS=Oryza sativa subsp. indica GN=TOP6A3 PE=1 SV=2 3 284 7.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40384|REC12_SCHPO Meiotic recombination protein rec12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec12 PE=1 SV=2 25 278 1.0E-35
sp|Q5ZPI9|SPO12_ORYSI Meiotic recombination protein SPO11-2 OS=Oryza sativa subsp. indica GN=SPO11-2 PE=1 SV=1 71 285 1.0E-35
sp|Q6ZD95|SPO12_ORYSJ Meiotic recombination protein SPO11-2 OS=Oryza sativa subsp. japonica GN=SPO11-2 PE=2 SV=1 71 285 1.0E-35
sp|Q0DSV9|TOP6A_ORYSJ Topoisomerase 6 subunit A3 OS=Oryza sativa subsp. japonica GN=SPO11-3 PE=2 SV=2 3 284 7.0E-34
sp|A2XFC1|TOP6A_ORYSI DNA topoisomerase 6 subunit A3 OS=Oryza sativa subsp. indica GN=TOP6A3 PE=1 SV=2 3 284 7.0E-34
sp|Q9Y5K1|SPO11_HUMAN Meiotic recombination protein SPO11 OS=Homo sapiens GN=SPO11 PE=2 SV=1 72 279 2.0E-33
sp|Q9WTK8|SPO11_MOUSE Meiotic recombination protein SPO11 OS=Mus musculus GN=Spo11 PE=2 SV=2 73 288 7.0E-33
sp|Q9M4A1|SPO12_ARATH Meiotic recombination protein SPO11-2 OS=Arabidopsis thaliana GN=SPO11-2 PE=1 SV=1 68 280 9.0E-32
sp|Q9LZ03|TOP6A_ARATH DNA topoisomerase 6 subunit A OS=Arabidopsis thaliana GN=TOP6A PE=1 SV=1 14 284 8.0E-30
sp|Q9M4A2|SPO11_ARATH Meiotic recombination protein SPO11-1 OS=Arabidopsis thaliana GN=SPO11-1 PE=1 SV=1 21 378 3.0E-28
sp|Q7Y021|SPO11_ORYSJ Meiotic recombination protein SPO11-1 OS=Oryza sativa subsp. japonica GN=SPO11-1 PE=2 SV=1 96 378 9.0E-26
sp|Q5ZPV8|SPO11_ORYSI Meiotic recombination protein SPO11-1 OS=Oryza sativa subsp. indica GN=SPO11-1 PE=2 SV=1 96 378 9.0E-26
sp|Q9YE67|TOP6A_AERPE Type 2 DNA topoisomerase 6 subunit A OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=top6A PE=3 SV=2 68 280 4.0E-24
sp|O05208|TOP6A_SULSH Type 2 DNA topoisomerase 6 subunit A OS=Sulfolobus shibatae GN=top6A PE=1 SV=1 68 279 8.0E-23
sp|Q971T1|TOP6A_SULTO Type 2 DNA topoisomerase 6 subunit A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=top6A PE=3 SV=1 68 279 1.0E-22
sp|Q22236|SPO11_CAEEL Meiotic recombination protein spo-11 OS=Caenorhabditis elegans GN=spo-11 PE=3 SV=1 74 279 2.0E-22
sp|A2BLE8|TOP6A_HYPBU Type 2 DNA topoisomerase 6 subunit A OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=top6A PE=3 SV=1 1 391 4.0E-22
sp|Q2QM00|SPO14_ORYSJ Meiotic recombination protein SPO11-4 OS=Oryza sativa subsp. japonica GN=SPO11-4 PE=1 SV=2 76 281 5.0E-21
sp|P23179|SPO11_YEAST Meiosis-specific protein SPO11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO11 PE=1 SV=1 17 273 8.0E-15
sp|Q5JH82|TOP6A_THEKO Type 2 DNA topoisomerase 6 subunit A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=top6A PE=3 SV=1 68 293 3.0E-14
sp|Q8U0K9|TOP6A_PYRFU Type 2 DNA topoisomerase 6 subunit A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=top6A PE=3 SV=1 68 293 7.0E-14
sp|C4VB43|SPO11_NOSCE Probable meiosis-specific protein SPO11 homolog OS=Nosema ceranae (strain BRL01) GN=SPO11 PE=3 SV=1 63 260 8.0E-14
sp|O59209|TOP6A_PYRHO Type 2 DNA topoisomerase 6 subunit A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=top6A PE=3 SV=2 68 293 3.0E-13
sp|Q9V134|TOP6A_PYRAB Type 2 DNA topoisomerase 6 subunit A OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=top6A PE=3 SV=1 68 293 3.0E-13
sp|Q8SVS9|SPO11_ENCCU Probable meiosis-specific protein SPO11 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPO11 PE=3 SV=1 62 261 4.0E-13
sp|Q3IPW7|TOP6A_NATPD Type 2 DNA topoisomerase 6 subunit A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=top6A PE=3 SV=1 34 284 3.0E-09
sp|O27089|TOP6A_METTH Type 2 DNA topoisomerase 6 subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=top6A PE=3 SV=1 68 284 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003677 DNA binding Yes
GO:0003824 catalytic activity Yes
GO:0006259 DNA metabolic process Yes
GO:0005694 chromosome Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043226 organelle No
GO:0043168 anion binding No
GO:0003676 nucleic acid binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4357
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3086 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1737
Ophiocordyceps camponoti-floridani Ophcf2|05303
Ophiocordyceps camponoti-rufipedis Ophun1|356
Ophiocordyceps kimflemingae Ophio5|2371
Ophiocordyceps subramaniannii Hirsu2|8981

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3086
MSETRQSARNMQQSDRATGALVARIEEMLEAVVSRIAAGQEMSIEMASRRRSGRNARSLRPVRFPGRNLAEAQKF
ARVLLILQLSHDALVAGRVLTKRHIFYQHQELFGKQRVVDDLVDDLALTLDVSREDLRIVASVKGLVVGPLVIRS
PDGAAIDTSLADTGTPIPTRQSVSSIEYGNLRWILVIEKDAIFRSLATCRFWQTSTAGTGLLITAKGYPDLNTRL
FLHMMHQQRPQLPILVLADFDPDGLGIFRCYRFGSEALAHEASAHNPKVRWLGIKSHHIQSMTTLHRGGLSSGSS
MASHEQVSTPAAAASRTSISSINCREPVSLLTMRDRRNIRCALASIARQDLDHVELVELRRELQVMLMMGVKAEI
QWLDEAGDITQWLSDKISRSLQDDE*
Coding >OphauG2|3086
ATGTCCGAGACTCGGCAGTCAGCCCGGAACATGCAGCAGAGCGACCGGGCAACTGGGGCCCTGGTAGCTCGGATA
GAAGAGATGCTCGAGGCTGTCGTGAGCCGCATTGCTGCTGGACAGGAAATGAGCATTGAAATGGCTTCTCGGAGA
CGCAGTGGCAGGAATGCACGAAGCCTTCGCCCGGTGCGTTTTCCAGGCAGAAACCTGGCCGAGGCTCAGAAATTC
GCCCGCGTGCTGCTCATCTTGCAGCTGTCCCACGATGCTCTAGTCGCAGGACGCGTCTTGACCAAGCGACACATT
TTTTACCAGCACCAGGAATTGTTTGGCAAGCAGCGAGTTGTTGACGACCTGGTTGACGACTTGGCTCTGACGCTA
GACGTCAGCCGCGAAGATCTCAGAATCGTGGCCTCTGTCAAAGGGCTTGTGGTTGGGCCCTTGGTAATCCGCTCG
CCTGATGGTGCGGCGATTGATACTTCCTTGGCAGACACGGGAACTCCGATTCCTACCAGGCAATCTGTATCGAGC
ATCGAATACGGCAACTTGAGATGGATCCTCGTGATTGAGAAAGACGCCATCTTTCGCTCCCTCGCCACATGCCGC
TTCTGGCAGACGTCGACGGCTGGCACTGGCCTTTTAATCACGGCCAAAGGGTACCCTGACCTTAACACTCGCTTA
TTCTTGCACATGATGCACCAGCAAAGACCACAACTCCCCATCCTTGTCTTGGCAGACTTTGATCCCGACGGGCTT
GGCATCTTTCGATGCTACCGATTCGGCTCCGAGGCTCTTGCCCATGAGGCGTCAGCACACAACCCCAAGGTACGC
TGGCTCGGAATCAAGTCGCATCACATTCAGAGCATGACGACGTTGCATCGAGGAGGCCTTTCTTCTGGCTCAAGC
ATGGCAAGCCACGAGCAAGTGTCGACGCCTGCTGCTGCTGCTTCGAGGACATCGATTTCGTCAATAAACTGTAGA
GAGCCAGTTTCTTTGCTCACAATGAGAGATCGCAGAAACATTAGATGTGCCTTGGCCAGCATTGCCAGACAAGAC
TTGGATCATGTCGAGCTGGTTGAGCTGAGGCGGGAGCTACAAGTCATGCTCATGATGGGTGTCAAGGCGGAGATT
CAGTGGCTTGATGAGGCTGGAGACATTACGCAATGGCTCTCTGACAAGATTTCCAGGTCGCTTCAAGATGATGAG
TAG
Transcript >OphauG2|3086
ATGTCCGAGACTCGGCAGTCAGCCCGGAACATGCAGCAGAGCGACCGGGCAACTGGGGCCCTGGTAGCTCGGATA
GAAGAGATGCTCGAGGCTGTCGTGAGCCGCATTGCTGCTGGACAGGAAATGAGCATTGAAATGGCTTCTCGGAGA
CGCAGTGGCAGGAATGCACGAAGCCTTCGCCCGGTGCGTTTTCCAGGCAGAAACCTGGCCGAGGCTCAGAAATTC
GCCCGCGTGCTGCTCATCTTGCAGCTGTCCCACGATGCTCTAGTCGCAGGACGCGTCTTGACCAAGCGACACATT
TTTTACCAGCACCAGGAATTGTTTGGCAAGCAGCGAGTTGTTGACGACCTGGTTGACGACTTGGCTCTGACGCTA
GACGTCAGCCGCGAAGATCTCAGAATCGTGGCCTCTGTCAAAGGGCTTGTGGTTGGGCCCTTGGTAATCCGCTCG
CCTGATGGTGCGGCGATTGATACTTCCTTGGCAGACACGGGAACTCCGATTCCTACCAGGCAATCTGTATCGAGC
ATCGAATACGGCAACTTGAGATGGATCCTCGTGATTGAGAAAGACGCCATCTTTCGCTCCCTCGCCACATGCCGC
TTCTGGCAGACGTCGACGGCTGGCACTGGCCTTTTAATCACGGCCAAAGGGTACCCTGACCTTAACACTCGCTTA
TTCTTGCACATGATGCACCAGCAAAGACCACAACTCCCCATCCTTGTCTTGGCAGACTTTGATCCCGACGGGCTT
GGCATCTTTCGATGCTACCGATTCGGCTCCGAGGCTCTTGCCCATGAGGCGTCAGCACACAACCCCAAGGTACGC
TGGCTCGGAATCAAGTCGCATCACATTCAGAGCATGACGACGTTGCATCGAGGAGGCCTTTCTTCTGGCTCAAGC
ATGGCAAGCCACGAGCAAGTGTCGACGCCTGCTGCTGCTGCTTCGAGGACATCGATTTCGTCAATAAACTGTAGA
GAGCCAGTTTCTTTGCTCACAATGAGAGATCGCAGAAACATTAGATGTGCCTTGGCCAGCATTGCCAGACAAGAC
TTGGATCATGTCGAGCTGGTTGAGCTGAGGCGGGAGCTACAAGTCATGCTCATGATGGGTGTCAAGGCGGAGATT
CAGTGGCTTGATGAGGCTGGAGACATTACGCAATGGCTCTCTGACAAGATTTCCAGGTCGCTTCAAGATGATGAG
TAG
Gene >OphauG2|3086
ATGTCCGAGACTCGGCAGTCAGCCCGGAACATGCAGCAGAGCGACCGGGCAACTGGGGCCCTGGTAGCTCGGATA
GAAGAGATGCTCGAGGCTGTCGTGAGCCGCATTGCTGCTGGACAGGAAATGAGCATTGAAATGGCTTCTCGGAGA
CGCAGTGGCAGGAATGCACGAAGCCTTCGCCCGGTGCGTTTTCCAGGCAGAAACCTGGCCGAGGCTCAGAAATTC
GGTACGGGAATTGTTTCGCCGCGGATGCTATTGGATGCTCATGGGTTTTGCAGCCCGCGTGCTGCTCATCTTGCA
GCTGTCCCACGATGCTCTAGTCGCAGGACGCGTCTTGACCAAGCGGTTTGTCTATCTGGGTCTCTCTCTCTTTTT
TTGCACTCCCTCGTTTTGATTGACCTTTTTTTAGACACATTTTTTACCAGCACCAGGAATTGTTTGGCAAGCAGC
GAGTTGTTGACGACCTGGTTGACGACTTGGCTCTGACGCTAGACGTCAGCCGCGAAGATCTCAGAATCGTAAGCC
ACTGGATAAAAGACGCCATGACACACAGGTCGAGCAAAGCTGACGCTTTACGTGCGGATTATAGGTGGCCTCTGT
CAAAGGGCTTGTGGTTGGGCCCTTGGTAATCCGCTCGCCTGATGGTGCGGCGATTGATACTTCCTTGGCAGACAC
GGTACCATGTTATATGCAGGGAGCAGCAGGTGTGACGGCCCGTCTGACACAAAGCAGGGAACTCCGATTCCTACC
AGGCAATCTGTATCGAGCATCGAATACGGCAACTTGAGATGGATCCTCGTGATTGAGAAAGACGTGGGCCAGGAA
CTGCCTCTGTTTTCAATGCCACCTTGCTCATATTGCATCAGGCCATCTTTCGCTCCCTCGCCACATGCCGCTTCT
GGCAGACGTCGACGGCTGGCACTGGCCTTTTAATCACGGTGAGACGCACATGGAACCAAATACAATGCATGCCAC
ATACTAACATGGCCATGATGGGGTACAGGCCAAAGGGTACCCTGACCTTAACACTCGCTTATTCTTGCACATGAT
GCACCAGCAAAGACCACAACTCCCCATCCTTGTCTTGGCAGACTTTGATCCCGACGGGCTTGGCATCTTTCGATG
CTACCGATTCGGCTCCGAGGCTCTTGCCCATGAGGCGTCAGCACACAACCCCAAGGTACGCTGGCTCGGAATCAA
GTCGCATCACATTCAGAGCATGACGACGTTGCATCGAGGAGGCCTTTCTTCTGGCTCAAGCATGGCAAGCCACGA
GCAAGTGTCGACGCCTGCTGCTGCTGCTTCGAGGACATCGATTTCGTCAATAAACTGTAGAGAGCCAGTTTCTTT
GCTCACAATGAGAGATCGCAGAAACATTAGATGTGCCTTGGCCAGCATTGCCAGACAAGACTTGGATCATGTCGA
GCTGGTTGAGCTGAGGCGGGAGCTACAAGTCATGCTCATGATGGGTGTCAAGGCGGAGATTCAGTGGCTTGATGA
GGCTGGAGACATTACGCAATGGCTCTCTGACAAGATTTCCAGGTCGCTTCAAGATGATGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail