Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3085
Gene name
LocationContig_227:7561..8623
Strand-
Gene length (bp)1062
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01227 GTP_cyclohydroI GTP cyclohydrolase I 1.1E-71 132 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51599|GCH1_NEUCR GTP cyclohydrolase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gch-1 PE=2 SV=2 56 311 8.0E-128
sp|O13774|GCH1_SCHPO GTP cyclohydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A5.13 PE=1 SV=1 70 308 1.0E-90
sp|P51601|GCH1_YEAST GTP cyclohydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL2 PE=1 SV=1 97 308 2.0E-90
sp|Q8YLL1|GCH11_NOSS1 GTP cyclohydrolase 1 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=folE1 PE=3 SV=1 106 307 6.0E-78
sp|Q55759|GCH1_SYNY3 GTP cyclohydrolase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=folE PE=3 SV=1 114 307 4.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51599|GCH1_NEUCR GTP cyclohydrolase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gch-1 PE=2 SV=2 56 311 8.0E-128
sp|O13774|GCH1_SCHPO GTP cyclohydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A5.13 PE=1 SV=1 70 308 1.0E-90
sp|P51601|GCH1_YEAST GTP cyclohydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL2 PE=1 SV=1 97 308 2.0E-90
sp|Q8YLL1|GCH11_NOSS1 GTP cyclohydrolase 1 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=folE1 PE=3 SV=1 106 307 6.0E-78
sp|Q55759|GCH1_SYNY3 GTP cyclohydrolase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=folE PE=3 SV=1 114 307 4.0E-77
sp|Q5N623|GCH1_SYNP6 GTP cyclohydrolase 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=folE PE=3 SV=1 130 307 2.0E-76
sp|Q54769|GCH1_SYNE7 GTP cyclohydrolase 1 OS=Synechococcus elongatus (strain PCC 7942) GN=folE PE=3 SV=2 130 307 2.0E-76
sp|B2J1L7|GCH1_NOSP7 GTP cyclohydrolase 1 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=folE PE=3 SV=1 127 307 4.0E-76
sp|Q8DJB8|GCH1_THEEB GTP cyclohydrolase 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=folE PE=3 SV=1 128 307 8.0E-76
sp|Q94465|GCH1_DICDI GTP cyclohydrolase 1 OS=Dictyostelium discoideum GN=gchA PE=1 SV=2 127 311 6.0E-75
sp|Q2JPT8|GCH1_SYNJB GTP cyclohydrolase 1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=folE PE=3 SV=1 130 307 1.0E-74
sp|P50141|GCH1_CHICK GTP cyclohydrolase 1 OS=Gallus gallus GN=GCH1 PE=2 SV=1 88 307 9.0E-74
sp|Q2JR69|GCH1_SYNJA GTP cyclohydrolase 1 OS=Synechococcus sp. (strain JA-3-3Ab) GN=folE PE=3 SV=1 130 307 2.0E-73
sp|P30793|GCH1_HUMAN GTP cyclohydrolase 1 OS=Homo sapiens GN=GCH1 PE=1 SV=1 111 307 3.0E-73
sp|O61573|GCH1_OSTOS GTP cyclohydrolase 1 OS=Ostertagia ostertagi GN=gch PE=2 SV=1 124 307 3.0E-73
sp|P22288|GCH1_RAT GTP cyclohydrolase 1 OS=Rattus norvegicus GN=Gch1 PE=1 SV=1 113 307 8.0E-73
sp|Q7NK98|GCH1_GLOVI GTP cyclohydrolase 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=folE PE=3 SV=1 117 307 7.0E-72
sp|Q05915|GCH1_MOUSE GTP cyclohydrolase 1 OS=Mus musculus GN=Gch1 PE=1 SV=1 121 307 1.0E-71
sp|Q19980|GCH1_CAEEL GTP cyclohydrolase 1 OS=Caenorhabditis elegans GN=cat-4 PE=1 SV=1 127 308 2.0E-70
sp|Q8EYG1|GCH1_LEPIN GTP cyclohydrolase 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=folE PE=3 SV=1 130 307 4.0E-69
sp|Q72LY8|GCH1_LEPIC GTP cyclohydrolase 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=folE PE=3 SV=1 130 307 4.0E-69
sp|Q056J8|GCH1_LEPBL GTP cyclohydrolase 1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=folE PE=3 SV=1 130 307 5.0E-69
sp|Q04P36|GCH1_LEPBJ GTP cyclohydrolase 1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=folE PE=3 SV=1 130 307 5.0E-69
sp|P51594|GCH1_CAMJE GTP cyclohydrolase 1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=folE PE=3 SV=2 128 308 2.0E-68
sp|A8FJZ5|GCH1_CAMJ8 GTP cyclohydrolase 1 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=folE PE=3 SV=1 128 308 3.0E-68
sp|Q5HWX4|GCH1_CAMJR GTP cyclohydrolase 1 OS=Campylobacter jejuni (strain RM1221) GN=folE PE=3 SV=1 128 308 6.0E-68
sp|A1VXS2|GCH1_CAMJJ GTP cyclohydrolase 1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=folE PE=3 SV=1 128 308 9.0E-68
sp|A7GW42|GCH1_CAMC5 GTP cyclohydrolase 1 OS=Campylobacter curvus (strain 525.92) GN=folE PE=3 SV=1 128 308 2.0E-67
sp|Q0A939|GCH1_ALKEH GTP cyclohydrolase 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=folE PE=3 SV=1 128 307 2.0E-67
sp|Q8YN49|GCH12_NOSS1 GTP cyclohydrolase 1 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=folE2 PE=3 SV=1 130 307 6.0E-67
sp|A7H1R1|GCH1_CAMJD GTP cyclohydrolase 1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=folE PE=3 SV=1 128 308 8.0E-67
sp|Q83DE3|GCH1_COXBU GTP cyclohydrolase 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=folE PE=3 SV=1 134 307 1.0E-66
sp|A9NDB3|GCH1_COXBR GTP cyclohydrolase 1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=folE PE=3 SV=1 134 307 1.0E-66
sp|A9KFF3|GCH1_COXBN GTP cyclohydrolase 1 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=folE PE=3 SV=1 134 307 1.0E-66
sp|Q607T5|GCH1_METCA GTP cyclohydrolase 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=folE PE=3 SV=1 137 308 2.0E-66
sp|Q8KEA8|GCH1_CHLTE GTP cyclohydrolase 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=folE PE=3 SV=1 127 308 8.0E-66
sp|B0SRX6|GCH1_LEPBP GTP cyclohydrolase 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=folE PE=3 SV=1 130 307 4.0E-65
sp|B0S8X8|GCH1_LEPBA GTP cyclohydrolase 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=folE PE=3 SV=1 130 307 4.0E-65
sp|Q1QV64|GCH1_CHRSD GTP cyclohydrolase 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=folE PE=3 SV=1 141 307 5.0E-65
sp|B9KDZ8|GCH1_CAMLR GTP cyclohydrolase 1 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=folE PE=3 SV=1 128 308 1.0E-64
sp|A4SF37|GCH1_CHLPM GTP cyclohydrolase 1 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=folE PE=3 SV=1 116 307 1.0E-64
sp|Q9HYG8|GCH11_PSEAE GTP cyclohydrolase 1 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=folE1 PE=3 SV=1 137 308 2.0E-64
sp|A7ZB36|GCH1_CAMC1 GTP cyclohydrolase 1 OS=Campylobacter concisus (strain 13826) GN=folE PE=3 SV=1 128 308 3.0E-64
sp|Q887V1|GCH11_PSESM GTP cyclohydrolase 1 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=folE1 PE=3 SV=1 137 312 3.0E-64
sp|Q9I351|GCH12_PSEAE GTP cyclohydrolase 1 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=folE2 PE=3 SV=1 136 307 4.0E-64
sp|Q3ATN0|GCH1_CHLCH GTP cyclohydrolase 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=folE PE=3 SV=1 128 307 8.0E-64
sp|Q884Q3|GCH12_PSESM GTP cyclohydrolase 1 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=folE2 PE=3 SV=1 141 307 1.0E-63
sp|Q15YG1|GCH1_PSEA6 GTP cyclohydrolase 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=folE PE=3 SV=1 137 308 2.0E-63
sp|Q88JY1|GCH12_PSEPK GTP cyclohydrolase 1 2 OS=Pseudomonas putida (strain KT2440) GN=folE2 PE=3 SV=1 135 308 8.0E-63
sp|C1DHG2|GCH1_AZOVD GTP cyclohydrolase 1 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=folE PE=3 SV=1 137 307 4.0E-62
sp|C5BL73|GCH1_TERTT GTP cyclohydrolase 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=folE PE=3 SV=1 137 307 5.0E-62
sp|Q7MWI5|GCH1_PORGI GTP cyclohydrolase 1 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=folE PE=3 SV=1 117 311 6.0E-62
sp|B2RIJ1|GCH1_PORG3 GTP cyclohydrolase 1 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=folE PE=3 SV=1 117 311 6.0E-62
sp|Q2SPJ2|GCH1_HAHCH GTP cyclohydrolase 1 OS=Hahella chejuensis (strain KCTC 2396) GN=folE PE=3 SV=1 127 307 8.0E-62
sp|Q3IF89|GCH1_PSEHT GTP cyclohydrolase 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=folE PE=3 SV=1 130 307 2.0E-61
sp|P48596|GCH1_DROME GTP cyclohydrolase 1 OS=Drosophila melanogaster GN=Pu PE=2 SV=3 125 308 3.0E-61
sp|Q9RYB4|GCH1_DEIRA GTP cyclohydrolase 1 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=folE PE=3 SV=1 137 307 2.0E-60
sp|Q88LV4|GCH11_PSEPK GTP cyclohydrolase 1 1 OS=Pseudomonas putida (strain KT2440) GN=folE1 PE=3 SV=1 137 307 1.0E-56
sp|Q82EE8|GCH1_STRAW GTP cyclohydrolase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=folE PE=3 SV=1 128 307 2.0E-56
sp|A6LFE8|GCH1_PARD8 GTP cyclohydrolase 1 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=folE PE=3 SV=1 117 311 2.0E-56
sp|P51596|GCH1_ONCMY GTP cyclohydrolase 1 (Fragment) OS=Oncorhynchus mykiss GN=gch1 PE=2 SV=1 113 276 3.0E-56
sp|Q9X8I3|GCH1_STRCO GTP cyclohydrolase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=folE PE=3 SV=1 128 307 9.0E-56
sp|Q8A0U0|GCH1_BACTN GTP cyclohydrolase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=folE PE=3 SV=1 118 307 1.0E-55
sp|Q47KU5|GCH1_THEFY GTP cyclohydrolase 1 OS=Thermobifida fusca (strain YX) GN=folE PE=3 SV=1 129 307 1.0E-55
sp|Q64P85|GCH1_BACFR GTP cyclohydrolase 1 OS=Bacteroides fragilis (strain YCH46) GN=folE PE=3 SV=1 118 307 9.0E-55
sp|Q5L925|GCH1_BACFN GTP cyclohydrolase 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=folE PE=3 SV=1 118 307 9.0E-55
sp|Q7M933|GCH1_WOLSU GTP cyclohydrolase 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=folE PE=3 SV=1 130 304 5.0E-54
sp|C3PJE8|GCH1_CORA7 GTP cyclohydrolase 1 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=folE PE=3 SV=1 128 307 8.0E-54
sp|B1VSG4|GCH1_STRGG GTP cyclohydrolase 1 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=folE PE=3 SV=1 128 307 1.0E-53
sp|A4J5D0|GCH1_DESRM GTP cyclohydrolase 1 OS=Desulfotomaculum reducens (strain MI-1) GN=folE PE=3 SV=1 127 307 2.0E-53
sp|Q3ADI2|GCH1_CARHZ GTP cyclohydrolase 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=folE PE=3 SV=1 128 308 6.0E-53
sp|C0QPU5|GCH1_PERMH GTP cyclohydrolase 1 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=folE PE=3 SV=1 128 307 9.0E-53
sp|B0K5C1|GCH1_THEPX GTP cyclohydrolase 1 OS=Thermoanaerobacter sp. (strain X514) GN=folE PE=3 SV=1 128 308 9.0E-53
sp|B0KCE5|GCH1_THEP3 GTP cyclohydrolase 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=folE PE=3 SV=1 128 308 9.0E-53
sp|Q6FZZ4|GCH1_BARQU GTP cyclohydrolase 1 OS=Bartonella quintana (strain Toulouse) GN=folE PE=3 SV=1 102 307 2.0E-52
sp|Q8NM84|GCH1_CORGL GTP cyclohydrolase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=folE PE=3 SV=1 128 307 2.0E-52
sp|Q8R7N2|GCH1_CALS4 GTP cyclohydrolase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=folE PE=3 SV=1 128 311 2.0E-52
sp|C0ZCC7|GCH1_BREBN GTP cyclohydrolase 1 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=folE PE=3 SV=1 127 307 3.0E-52
sp|A4VVH1|GCH1_STRSY GTP cyclohydrolase 1 OS=Streptococcus suis (strain 05ZYH33) GN=folE PE=3 SV=1 128 307 5.0E-52
sp|A4W1S9|GCH1_STRS2 GTP cyclohydrolase 1 OS=Streptococcus suis (strain 98HAH33) GN=folE PE=3 SV=1 128 307 5.0E-52
sp|A4QH94|GCH1_CORGB GTP cyclohydrolase 1 OS=Corynebacterium glutamicum (strain R) GN=folE PE=3 SV=1 128 307 9.0E-52
sp|P9WN57|GCH1_MYCTU GTP cyclohydrolase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=folE PE=1 SV=1 119 307 1.0E-51
sp|P9WN56|GCH1_MYCTO GTP cyclohydrolase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=folE PE=3 SV=1 119 307 1.0E-51
sp|A5U8T4|GCH1_MYCTA GTP cyclohydrolase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=folE PE=3 SV=1 119 307 1.0E-51
sp|C1AI67|GCH1_MYCBT GTP cyclohydrolase 1 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=folE PE=3 SV=1 119 307 1.0E-51
sp|A1KPU4|GCH1_MYCBP GTP cyclohydrolase 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=folE PE=3 SV=1 119 307 1.0E-51
sp|P64208|GCH1_MYCBO GTP cyclohydrolase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=folE PE=3 SV=1 119 307 1.0E-51
sp|Q3K0Y1|GCH1_STRA1 GTP cyclohydrolase 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=folE PE=3 SV=1 128 307 1.0E-51
sp|A1TG42|GCH1_MYCVP GTP cyclohydrolase 1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=folE PE=3 SV=1 124 307 1.0E-51
sp|B1HTA3|GCH1_LYSSC GTP cyclohydrolase 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=folE PE=3 SV=1 127 310 1.0E-51
sp|Q8E549|GCH1_STRA3 GTP cyclohydrolase 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=folE PE=3 SV=1 128 307 1.0E-51
sp|A0RBW5|GCH1_BACAH GTP cyclohydrolase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=folE PE=3 SV=1 123 307 2.0E-51
sp|O66603|GCH1_AQUAE GTP cyclohydrolase 1 OS=Aquifex aeolicus (strain VF5) GN=folE PE=3 SV=1 128 307 2.0E-51
sp|Q3ZYB5|GCH1_DEHMC GTP cyclohydrolase 1 OS=Dehalococcoides mccartyi (strain CBDB1) GN=folE PE=3 SV=1 130 307 2.0E-51
sp|A5FQD3|GCH1_DEHMB GTP cyclohydrolase 1 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=folE PE=3 SV=1 130 307 2.0E-51
sp|A5VQL0|GCH1_BRUO2 GTP cyclohydrolase 1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=folE PE=3 SV=1 132 307 3.0E-51
sp|B2V9P4|GCH1_SULSY GTP cyclohydrolase 1 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=folE PE=3 SV=1 129 308 4.0E-51
sp|A9VMC0|GCH1_BACWK GTP cyclohydrolase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=folE PE=3 SV=1 123 310 4.0E-51
sp|Q8DZI5|GCH1_STRA5 GTP cyclohydrolase 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=folE PE=3 SV=1 128 307 5.0E-51
sp|Q6G3J8|GCH1_BARHE GTP cyclohydrolase 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=folE PE=3 SV=1 104 307 8.0E-51
sp|Q9KCC7|GCH1_BACHD GTP cyclohydrolase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=folE PE=3 SV=1 128 307 9.0E-51
sp|B0CGM4|GCH1_BRUSI GTP cyclohydrolase 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=folE PE=3 SV=1 132 307 9.0E-51
sp|Q8YH94|GCH1_BRUME GTP cyclohydrolase 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=folE PE=3 SV=1 132 307 9.0E-51
sp|C0RJ47|GCH1_BRUMB GTP cyclohydrolase 1 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=folE PE=3 SV=1 132 307 9.0E-51
sp|Q57D61|GCH1_BRUAB GTP cyclohydrolase 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=folE PE=3 SV=1 132 307 9.0E-51
sp|Q2YQ03|GCH1_BRUA2 GTP cyclohydrolase 1 OS=Brucella abortus (strain 2308) GN=folE PE=3 SV=1 132 307 9.0E-51
sp|B2S5T0|GCH1_BRUA1 GTP cyclohydrolase 1 OS=Brucella abortus (strain S19) GN=folE PE=3 SV=1 132 307 9.0E-51
sp|A5D2D8|GCH1_PELTS GTP cyclohydrolase 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=folE PE=3 SV=1 129 307 1.0E-50
sp|Q6HL44|GCH1_BACHK GTP cyclohydrolase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|Q63DM1|GCH1_BACCZ GTP cyclohydrolase 1 OS=Bacillus cereus (strain ZK / E33L) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|Q81FQ8|GCH1_BACCR GTP cyclohydrolase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|B9IVN3|GCH1_BACCQ GTP cyclohydrolase 1 OS=Bacillus cereus (strain Q1) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|B7HL21|GCH1_BACC7 GTP cyclohydrolase 1 OS=Bacillus cereus (strain AH187) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|B7HHR5|GCH1_BACC4 GTP cyclohydrolase 1 OS=Bacillus cereus (strain B4264) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|C1EN08|GCH1_BACC3 GTP cyclohydrolase 1 OS=Bacillus cereus (strain 03BB102) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|B7IP89|GCH1_BACC2 GTP cyclohydrolase 1 OS=Bacillus cereus (strain G9842) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|Q73AY4|GCH1_BACC1 GTP cyclohydrolase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|B7JGZ6|GCH1_BACC0 GTP cyclohydrolase 1 OS=Bacillus cereus (strain AH820) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|Q81SW2|GCH1_BACAN GTP cyclohydrolase 1 OS=Bacillus anthracis GN=folE PE=3 SV=1 123 307 1.0E-50
sp|C3L8S8|GCH1_BACAC GTP cyclohydrolase 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|C3P598|GCH1_BACAA GTP cyclohydrolase 1 OS=Bacillus anthracis (strain A0248) GN=folE PE=3 SV=1 123 307 1.0E-50
sp|O69531|GCH1_MYCLE GTP cyclohydrolase 1 OS=Mycobacterium leprae (strain TN) GN=folE PE=3 SV=1 128 307 2.0E-50
sp|B8ZU42|GCH1_MYCLB GTP cyclohydrolase 1 OS=Mycobacterium leprae (strain Br4923) GN=folE PE=3 SV=1 128 307 2.0E-50
sp|Q5M391|GCH1_STRT2 GTP cyclohydrolase 1 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=folE PE=3 SV=1 128 307 2.0E-50
sp|Q5LYM8|GCH1_STRT1 GTP cyclohydrolase 1 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=folE PE=3 SV=1 128 307 2.0E-50
sp|Q8G0L4|GCH1_BRUSU GTP cyclohydrolase 1 OS=Brucella suis biovar 1 (strain 1330) GN=folE PE=3 SV=1 132 307 3.0E-50
sp|A9M586|GCH1_BRUC2 GTP cyclohydrolase 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=folE PE=3 SV=1 132 307 3.0E-50
sp|B0U794|GCH1_XYLFM GTP cyclohydrolase 1 OS=Xylella fastidiosa (strain M12) GN=folE PE=3 SV=1 133 310 3.0E-50
sp|Q11JM4|GCH1_CHESB GTP cyclohydrolase 1 OS=Chelativorans sp. (strain BNC1) GN=folE PE=3 SV=1 128 312 3.0E-50
sp|Q3Z782|GCH1_DEHM1 GTP cyclohydrolase 1 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=folE PE=3 SV=1 130 307 5.0E-50
sp|A7GN48|GCH1_BACCN GTP cyclohydrolase 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=folE PE=3 SV=1 123 307 6.0E-50
sp|Q3BM80|GCH1_XANC5 GTP cyclohydrolase 1 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=folE PE=3 SV=1 133 307 7.0E-50
sp|Q5KXT7|GCH1_GEOKA GTP cyclohydrolase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=folE PE=3 SV=1 133 307 7.0E-50
sp|Q8P3B0|GCH1_XANCP GTP cyclohydrolase 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=folE PE=3 SV=2 133 307 8.0E-50
sp|P56462|GCH1_HELPY GTP cyclohydrolase 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=folE PE=3 SV=1 130 307 8.0E-50
sp|Q9PC02|GCH1_XYLFA GTP cyclohydrolase 1 OS=Xylella fastidiosa (strain 9a5c) GN=folE PE=3 SV=2 133 310 9.0E-50
sp|A3DHH6|GCH1_CLOTH GTP cyclohydrolase 1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=folE PE=3 SV=1 128 307 1.0E-49
sp|Q8PEP3|GCH1_XANAC GTP cyclohydrolase 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=folE PE=3 SV=2 133 307 1.0E-49
sp|B1MGU9|GCH1_MYCA9 GTP cyclohydrolase 1 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=folE PE=3 SV=1 129 307 1.0E-49
sp|A4T5P2|GCH1_MYCGI GTP cyclohydrolase 1 OS=Mycobacterium gilvum (strain PYR-GCK) GN=folE PE=3 SV=1 129 307 1.0E-49
sp|Q743Z2|GCH1_MYCPA GTP cyclohydrolase 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=folE PE=3 SV=1 106 307 3.0E-49
sp|B2UU76|GCH1_HELPS GTP cyclohydrolase 1 OS=Helicobacter pylori (strain Shi470) GN=folE PE=3 SV=1 130 307 3.0E-49
sp|Q8FMG3|GCH1_COREF GTP cyclohydrolase 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=folE PE=3 SV=1 128 307 4.0E-49
sp|B2HJ53|GCH1_MYCMM GTP cyclohydrolase 1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=folE PE=3 SV=1 129 307 4.0E-49
sp|A0PV57|GCH1_MYCUA GTP cyclohydrolase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=folE PE=3 SV=1 129 307 4.0E-49
sp|B9JWF1|GCH1_AGRVS GTP cyclohydrolase 1 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=folE PE=3 SV=1 128 307 6.0E-49
sp|Q18BW7|GCH1_PEPD6 GTP cyclohydrolase 1 OS=Peptoclostridium difficile (strain 630) GN=folE PE=3 SV=1 128 310 7.0E-49
sp|A8AZD8|GCH1_STRGC GTP cyclohydrolase 1 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=folE PE=3 SV=1 127 307 7.0E-49
sp|B6JME9|GCH1_HELP2 GTP cyclohydrolase 1 OS=Helicobacter pylori (strain P12) GN=folE PE=3 SV=1 130 307 7.0E-49
sp|B5Z7T2|GCH1_HELPG GTP cyclohydrolase 1 OS=Helicobacter pylori (strain G27) GN=folE PE=3 SV=1 130 307 1.0E-48
sp|A7Z630|GCH1_BACMF GTP cyclohydrolase 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=folE PE=3 SV=1 128 304 1.0E-48
sp|P0A3E9|GCH1_STRP8 GTP cyclohydrolase 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=folE PE=3 SV=1 128 307 1.0E-48
sp|Q5XCA9|GCH1_STRP6 GTP cyclohydrolase 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=folE PE=3 SV=2 128 307 1.0E-48
sp|P0C0C2|GCH1_STRP1 GTP cyclohydrolase 1 OS=Streptococcus pyogenes serotype M1 GN=folE PE=3 SV=1 128 307 1.0E-48
sp|A0QA85|GCH1_MYCA1 GTP cyclohydrolase 1 OS=Mycobacterium avium (strain 104) GN=folE PE=3 SV=1 106 307 1.0E-48
sp|Q8Y5X1|GCH1_LISMO GTP cyclohydrolase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=folE PE=1 SV=1 128 310 1.0E-48
sp|C5D3E8|GCH1_GEOSW GTP cyclohydrolase 1 OS=Geobacillus sp. (strain WCH70) GN=folE PE=3 SV=1 128 307 1.0E-48
sp|A1USJ5|GCH1_BARBK GTP cyclohydrolase 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=folE PE=3 SV=1 127 306 1.0E-48
sp|A2REL9|GCH1_STRPG GTP cyclohydrolase 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=folE PE=3 SV=1 128 307 2.0E-48
sp|P0DB31|GCH1_STRPQ GTP cyclohydrolase 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=folE PE=3 SV=1 128 307 2.0E-48
sp|P0DB30|GCH1_STRP3 GTP cyclohydrolase 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=folE PE=3 SV=1 128 307 2.0E-48
sp|Q9ZKS2|GCH1_HELPJ GTP cyclohydrolase 1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=folE PE=3 SV=1 130 307 3.0E-48
sp|P19465|GCH1_BACSU GTP cyclohydrolase 1 OS=Bacillus subtilis (strain 168) GN=folE PE=1 SV=1 128 304 4.0E-48
sp|B0U881|GCH1_METS4 GTP cyclohydrolase 1 OS=Methylobacterium sp. (strain 4-46) GN=folE PE=3 SV=1 132 307 4.0E-48
sp|B8DBZ3|GCH1_LISMH GTP cyclohydrolase 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=folE PE=3 SV=1 128 310 4.0E-48
sp|Q87D63|GCH1_XYLFT GTP cyclohydrolase 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=folE PE=3 SV=1 133 310 5.0E-48
sp|B2I4L2|GCH1_XYLF2 GTP cyclohydrolase 1 OS=Xylella fastidiosa (strain M23) GN=folE PE=3 SV=1 133 310 5.0E-48
sp|B2IBC4|GCH1_BEII9 GTP cyclohydrolase 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=folE PE=3 SV=1 128 307 5.0E-48
sp|Q17WX5|GCH1_HELAH GTP cyclohydrolase 1 OS=Helicobacter acinonychis (strain Sheeba) GN=folE PE=3 SV=1 130 307 5.0E-48
sp|Q7UJJ7|GCH1_RHOBA GTP cyclohydrolase 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=folE PE=3 SV=1 98 308 6.0E-48
sp|Q98LQ6|GCH1_RHILO GTP cyclohydrolase 1 OS=Rhizobium loti (strain MAFF303099) GN=folE PE=3 SV=1 133 307 7.0E-48
sp|Q71Y82|GCH1_LISMF GTP cyclohydrolase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=folE PE=3 SV=1 128 310 8.0E-48
sp|C1KWN3|GCH1_LISMC GTP cyclohydrolase 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=folE PE=3 SV=1 128 310 8.0E-48
sp|Q1CSU6|GCH1_HELPH GTP cyclohydrolase 1 OS=Helicobacter pylori (strain HPAG1) GN=folE PE=3 SV=1 130 307 9.0E-48
sp|A8FEL2|GCH1_BACP2 GTP cyclohydrolase 1 OS=Bacillus pumilus (strain SAFR-032) GN=folE PE=3 SV=1 128 307 1.0E-47
sp|B3DR12|GCH1_BIFLD GTP cyclohydrolase 1 OS=Bifidobacterium longum (strain DJO10A) GN=folE PE=3 SV=1 128 307 1.0E-47
sp|B5XLE8|GCH1_STRPZ GTP cyclohydrolase 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=folE PE=3 SV=1 128 307 2.0E-47
sp|Q89IW2|GCH1_BRADU GTP cyclohydrolase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=folE PE=3 SV=1 132 307 2.0E-47
sp|Q8DUG2|GCH1_STRMU GTP cyclohydrolase 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=folE PE=3 SV=1 128 310 2.0E-47
sp|Q92A75|GCH1_LISIN GTP cyclohydrolase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=folE PE=3 SV=1 128 310 2.0E-47
sp|A0AK45|GCH1_LISW6 GTP cyclohydrolase 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=folE PE=3 SV=1 128 310 2.0E-47
sp|P0C0C1|GCH1_STRPY GTP cyclohydrolase 1 OS=Streptococcus pyogenes GN=folE PE=3 SV=1 128 307 3.0E-47
sp|Q8G3S1|GCH1_BIFLO GTP cyclohydrolase 1 OS=Bifidobacterium longum (strain NCC 2705) GN=folE PE=3 SV=1 128 307 5.0E-47
sp|Q4FL89|GCH1_PELUB GTP cyclohydrolase 1 OS=Pelagibacter ubique (strain HTCC1062) GN=folE PE=3 SV=1 133 307 9.0E-47
sp|A5N6S3|GCH1_CLOK5 GTP cyclohydrolase 1 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=folE PE=3 SV=1 129 309 1.0E-46
sp|B9E092|GCH1_CLOK1 GTP cyclohydrolase 1 OS=Clostridium kluyveri (strain NBRC 12016) GN=folE PE=3 SV=1 129 309 1.0E-46
sp|A6U8C2|GCH1_SINMW GTP cyclohydrolase 1 OS=Sinorhizobium medicae (strain WSM419) GN=folE PE=3 SV=1 133 307 2.0E-46
sp|B5YJV0|GCH1_THEYD GTP cyclohydrolase 1 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=folE PE=3 SV=1 128 308 7.0E-46
sp|C3MB45|GCH1_RHISN GTP cyclohydrolase 1 OS=Rhizobium sp. (strain NGR234) GN=folE PE=3 SV=1 133 307 7.0E-46
sp|Q8XLM2|GCH1_CLOPE GTP cyclohydrolase 1 OS=Clostridium perfringens (strain 13 / Type A) GN=folE PE=3 SV=1 128 309 8.0E-46
sp|Q68WZ4|GCH1_RICTY GTP cyclohydrolase 1 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=folE PE=3 SV=1 128 308 1.0E-45
sp|Q4ULX3|GCH1_RICFE GTP cyclohydrolase 1 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=folE PE=3 SV=1 128 308 1.0E-45
sp|A8HUG2|GCH1_AZOC5 GTP cyclohydrolase 1 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=folE PE=3 SV=1 132 307 2.0E-45
sp|A6X0X0|GCH1_OCHA4 GTP cyclohydrolase 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=folE PE=3 SV=1 132 306 3.0E-45
sp|Q1RID0|GCH1_RICBR GTP cyclohydrolase 1 OS=Rickettsia bellii (strain RML369-C) GN=folE PE=3 SV=1 128 306 3.0E-45
sp|A8GUB6|GCH1_RICB8 GTP cyclohydrolase 1 OS=Rickettsia bellii (strain OSU 85-389) GN=folE PE=3 SV=1 128 306 3.0E-45
sp|C3PNA0|GCH1_RICAE GTP cyclohydrolase 1 OS=Rickettsia africae (strain ESF-5) GN=folE PE=3 SV=1 133 308 3.0E-45
sp|Q0STY9|GCH1_CLOPS GTP cyclohydrolase 1 OS=Clostridium perfringens (strain SM101 / Type A) GN=folE PE=3 SV=1 128 309 4.0E-45
sp|Q92I93|GCH1_RICCN GTP cyclohydrolase 1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=folE PE=3 SV=1 128 308 5.0E-45
sp|Q9ZDE8|GCH1_RICPR GTP cyclohydrolase 1 OS=Rickettsia prowazekii (strain Madrid E) GN=folE PE=3 SV=1 128 308 6.0E-45
sp|Q2IY20|GCH1_RHOP2 GTP cyclohydrolase 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=folE PE=3 SV=1 132 307 9.0E-45
sp|A0Q2L7|GCH1_CLONN GTP cyclohydrolase 1 OS=Clostridium novyi (strain NT) GN=folE PE=3 SV=1 128 309 9.0E-45
sp|A8F1F2|GCH1_RICM5 GTP cyclohydrolase 1 OS=Rickettsia massiliae (strain Mtu5) GN=folE PE=3 SV=1 128 308 1.0E-44
sp|Q0TRM0|GCH1_CLOP1 GTP cyclohydrolase 1 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=folE PE=3 SV=1 128 309 1.0E-44
sp|A8GRW0|GCH1_RICRS GTP cyclohydrolase 1 OS=Rickettsia rickettsii (strain Sheila Smith) GN=folE PE=3 SV=1 128 308 1.0E-44
sp|B0BXB8|GCH1_RICRO GTP cyclohydrolase 1 OS=Rickettsia rickettsii (strain Iowa) GN=folE PE=3 SV=1 128 308 1.0E-44
sp|A8GN89|GCH1_RICAH GTP cyclohydrolase 1 OS=Rickettsia akari (strain Hartford) GN=folE PE=3 SV=1 133 306 2.0E-44
sp|B0S1R1|GCH1_FINM2 GTP cyclohydrolase 1 OS=Finegoldia magna (strain ATCC 29328) GN=folE PE=3 SV=1 128 309 3.0E-44
sp|C4K2D8|GCH1_RICPU GTP cyclohydrolase 1 OS=Rickettsia peacockii (strain Rustic) GN=folE PE=3 SV=1 128 308 3.0E-44
sp|Q134L7|GCH1_RHOPS GTP cyclohydrolase 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=folE PE=3 SV=1 133 307 6.0E-44
sp|Q92QB4|GCH1_RHIME GTP cyclohydrolase 1 OS=Rhizobium meliloti (strain 1021) GN=folE PE=3 SV=1 98 279 1.0E-43
sp|B3QE25|GCH1_RHOPT GTP cyclohydrolase 1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=folE PE=3 SV=1 132 307 2.0E-43
sp|Q6N4E7|GCH1_RHOPA GTP cyclohydrolase 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=folE PE=3 SV=1 132 307 2.0E-43
sp|B8ZL26|GCH1_STRPJ GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=folE PE=3 SV=1 128 309 3.0E-43
sp|Q8UEK8|GCH1_AGRFC GTP cyclohydrolase 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=folE PE=3 SV=1 133 279 4.0E-43
sp|Q2Y6B3|GCH1_NITMU GTP cyclohydrolase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=folE PE=3 SV=1 132 306 7.0E-43
sp|Q0AM02|GCH1_MARMM GTP cyclohydrolase 1 OS=Maricaulis maris (strain MCS10) GN=folE PE=3 SV=1 128 307 8.0E-43
sp|P51595|GCH1_STRPN GTP cyclohydrolase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=folE PE=3 SV=2 128 309 9.0E-43
sp|C1CB65|GCH1_STRP7 GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain 70585) GN=folE PE=3 SV=1 128 309 9.0E-43
sp|B5E6W5|GCH1_STRP4 GTP cyclohydrolase 1 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=folE PE=3 SV=1 128 309 9.0E-43
sp|P59656|GCH1_STRR6 GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=folE PE=3 SV=1 128 309 2.0E-42
sp|Q04MF9|GCH1_STRP2 GTP cyclohydrolase 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=folE PE=3 SV=1 128 309 2.0E-42
sp|Q212N0|GCH1_RHOPB GTP cyclohydrolase 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=folE PE=3 SV=1 133 307 2.0E-42
sp|A3CKF4|GCH1_STRSV GTP cyclohydrolase 1 OS=Streptococcus sanguinis (strain SK36) GN=folE PE=3 SV=1 128 308 2.0E-42
sp|B4U640|GCH1_HYDS0 GTP cyclohydrolase 1 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=folE PE=3 SV=1 128 307 2.0E-42
sp|Q0BXB5|GCH1_HYPNA GTP cyclohydrolase 1 OS=Hyphomonas neptunium (strain ATCC 15444) GN=folE PE=3 SV=1 133 308 4.0E-42
sp|C1CIH2|GCH1_STRZP GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain P1031) GN=folE PE=3 SV=1 128 309 4.0E-42
sp|C1CC81|GCH1_STRZJ GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain JJA) GN=folE PE=3 SV=1 128 309 4.0E-42
sp|B2ISL9|GCH1_STRPS GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain CGSP14) GN=folE PE=3 SV=1 128 309 4.0E-42
sp|B1I918|GCH1_STRPI GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=folE PE=3 SV=1 128 309 4.0E-42
sp|A6SZ52|GCH1_JANMA GTP cyclohydrolase 1 OS=Janthinobacterium sp. (strain Marseille) GN=folE PE=3 SV=1 137 306 6.0E-42
sp|C1CPG4|GCH1_STRZT GTP cyclohydrolase 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=folE PE=3 SV=1 128 309 9.0E-42
sp|A2BL58|GCH1_HYPBU GTP cyclohydrolase 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=folE PE=3 SV=1 129 307 1.0E-40
sp|P51600|GCH1_PHYBL GTP cyclohydrolase 1 (Fragment) OS=Phycomyces blakesleeanus PE=2 SV=1 183 276 1.0E-40
sp|A8MC60|GCH1_CALMQ GTP cyclohydrolase 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=folE PE=3 SV=1 130 307 7.0E-40
sp|Q980E8|GCH1_SULSO GTP cyclohydrolase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=folE PE=3 SV=1 114 307 8.0E-40
sp|Q9CGE3|FOLKE_LACLA Bifunctional protein FolKE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=folKE PE=3 SV=1 112 304 2.0E-39
sp|C3N7B7|GCH1_SULIY GTP cyclohydrolase 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=folE PE=3 SV=1 134 307 3.0E-39
sp|C3MXF1|GCH1_SULIM GTP cyclohydrolase 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=folE PE=3 SV=1 134 307 3.0E-39
sp|C3MR62|GCH1_SULIL GTP cyclohydrolase 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=folE PE=3 SV=1 134 307 3.0E-39
sp|C4KIH5|GCH1_SULIK GTP cyclohydrolase 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=folE PE=3 SV=1 134 307 3.0E-39
sp|C3MZ97|GCH1_SULIA GTP cyclohydrolase 1 OS=Sulfolobus islandicus (strain M.16.27) GN=folE PE=3 SV=1 134 307 3.0E-39
sp|Q9AAY3|GCH1_CAUCR GTP cyclohydrolase 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=folE PE=3 SV=1 132 307 4.0E-39
sp|Q8GJP4|FOLKE_LACLM Bifunctional protein FolKE OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=folKE PE=3 SV=1 112 304 4.0E-39
sp|C3NGB7|GCH1_SULIN GTP cyclohydrolase 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=folE PE=3 SV=1 134 307 5.0E-39
sp|Q971G9|GCH1_SULTO GTP cyclohydrolase 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=folE PE=3 SV=2 116 307 4.0E-38
sp|Q7VFG4|GCH1_HELHP GTP cyclohydrolase 1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=folE PE=3 SV=1 136 307 6.0E-38
sp|Q82Z12|GCH1_ENTFA GTP cyclohydrolase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=folE PE=3 SV=1 121 304 1.0E-37
sp|Q4J8S2|GCH1_SULAC GTP cyclohydrolase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=folE PE=3 SV=1 116 311 2.0E-36
sp|Q6ACQ1|GCH1_LEIXX GTP cyclohydrolase 1 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=folE PE=3 SV=1 129 308 7.0E-36
sp|Q38WN0|GCH1_LACSS GTP cyclohydrolase 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=folE PE=3 SV=1 121 307 7.0E-36
sp|Q88ST4|GCH1_LACPL GTP cyclohydrolase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=folE PE=3 SV=1 121 308 3.0E-35
sp|Q8RH43|GCH1_FUSNN GTP cyclohydrolase 1 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=folE PE=3 SV=1 129 307 1.0E-34
sp|B8I184|GCH1_CLOCE GTP cyclohydrolase 1 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=folE PE=3 SV=1 128 306 2.0E-33
sp|A5FHM7|GCH1_FLAJ1 GTP cyclohydrolase 1 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=folE PE=3 SV=1 99 310 3.0E-33
sp|B1L1S1|GCH1_CLOBM GTP cyclohydrolase 1 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=folE PE=3 SV=1 128 306 1.0E-32
sp|B1IL94|GCH1_CLOBK GTP cyclohydrolase 1 OS=Clostridium botulinum (strain Okra / Type B1) GN=folE PE=3 SV=1 128 306 2.0E-32
sp|A5I231|GCH1_CLOBH GTP cyclohydrolase 1 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=folE PE=3 SV=1 128 306 2.0E-32
sp|A7FU67|GCH1_CLOB1 GTP cyclohydrolase 1 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=folE PE=3 SV=1 128 306 2.0E-32
sp|C1FN26|GCH1_CLOBJ GTP cyclohydrolase 1 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=folE PE=3 SV=1 128 306 3.0E-32
sp|A7GDP1|GCH1_CLOBL GTP cyclohydrolase 1 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=folE PE=3 SV=1 128 306 4.0E-32
sp|C3KVW3|GCH1_CLOB6 GTP cyclohydrolase 1 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=folE PE=3 SV=1 137 306 9.0E-32
sp|B0UUA9|GCH1_HISS2 GTP cyclohydrolase 1 OS=Histophilus somni (strain 2336) GN=folE PE=3 SV=1 137 307 3.0E-31
sp|Q0I3F6|GCH1_HAES1 GTP cyclohydrolase 1 OS=Haemophilus somnus (strain 129Pt) GN=folE PE=3 SV=1 137 307 3.0E-31
sp|Q65TR0|GCH1_MANSM GTP cyclohydrolase 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=folE PE=3 SV=1 137 308 4.0E-31
sp|B0BPI8|GCH1_ACTPJ GTP cyclohydrolase 1 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=folE PE=3 SV=1 104 308 5.0E-31
sp|B3GXP9|GCH1_ACTP7 GTP cyclohydrolase 1 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=folE PE=3 SV=1 104 308 5.0E-31
sp|A3N0R3|GCH1_ACTP2 GTP cyclohydrolase 1 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=folE PE=3 SV=1 104 308 5.0E-31
sp|P43866|GCH1_HAEIN GTP cyclohydrolase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folE PE=3 SV=1 119 307 5.0E-31
sp|Q8KA05|GCH1_BUCAP GTP cyclohydrolase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=folE PE=3 SV=1 104 304 5.0E-31
sp|A5UC59|GCH1_HAEIE GTP cyclohydrolase 1 OS=Haemophilus influenzae (strain PittEE) GN=folE PE=3 SV=1 102 307 5.0E-31
sp|Q4QKH4|GCH1_HAEI8 GTP cyclohydrolase 1 OS=Haemophilus influenzae (strain 86-028NP) GN=folE PE=3 SV=1 102 307 5.0E-31
sp|P57865|GCH1_PASMU GTP cyclohydrolase 1 OS=Pasteurella multocida (strain Pm70) GN=folE PE=3 SV=1 137 308 3.0E-30
sp|A5UEW4|GCH1_HAEIG GTP cyclohydrolase 1 OS=Haemophilus influenzae (strain PittGG) GN=folE PE=3 SV=1 105 307 3.0E-30
sp|Q8VYU3|GCH1_SOLLC GTP cyclohydrolase 1 OS=Solanum lycopersicum GN=GCH1 PE=1 SV=1 130 270 6.0E-30
sp|Q7VM90|GCH1_HAEDU GTP cyclohydrolase 1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=folE PE=3 SV=1 104 307 9.0E-30
sp|Q97D54|GCH1_CLOAB GTP cyclohydrolase 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=folE PE=3 SV=1 134 306 1.0E-29
sp|P51597|GCH1_EUGGR GTP cyclohydrolase 1 (Fragment) OS=Euglena gracilis PE=2 SV=1 198 276 1.0E-29
sp|C4LDE6|GCH1_TOLAT GTP cyclohydrolase 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=folE PE=3 SV=1 100 305 7.0E-29
sp|A6LWG6|GCH1_CLOB8 GTP cyclohydrolase 1 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=folE PE=3 SV=1 128 307 1.0E-28
sp|P51598|GCH1_MUCPU GTP cyclohydrolase 1 (Fragment) OS=Mucuna pruriens var. utilis PE=2 SV=1 198 276 3.0E-28
sp|A0KIN6|GCH1_AERHH GTP cyclohydrolase 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=folE PE=3 SV=1 105 311 8.0E-28
sp|A4SPE8|GCH1_AERS4 GTP cyclohydrolase 1 OS=Aeromonas salmonicida (strain A449) GN=folE PE=3 SV=1 100 304 2.0E-27
sp|Q492J7|GCH1_BLOPB GTP cyclohydrolase 1 OS=Blochmannia pennsylvanicus (strain BPEN) GN=folE PE=3 SV=1 130 304 6.0E-27
sp|Q9KLX5|GCH1_VIBCH GTP cyclohydrolase 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=folE PE=3 SV=2 102 304 9.0E-27
sp|Q8VYU3|GCH1_SOLLC GTP cyclohydrolase 1 OS=Solanum lycopersicum GN=GCH1 PE=1 SV=1 130 304 1.0E-26
sp|A7N6L2|GCH1_VIBCB GTP cyclohydrolase 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=folE PE=3 SV=1 100 304 1.0E-26
sp|A1JU09|GCH1_YERE8 GTP cyclohydrolase 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=folE PE=3 SV=1 117 307 1.0E-26
sp|Q7MDE5|GCH1_VIBVY GTP cyclohydrolase 1 OS=Vibrio vulnificus (strain YJ016) GN=folE PE=3 SV=1 100 304 1.0E-26
sp|Q8D6I7|GCH1_VIBVU GTP cyclohydrolase 1 OS=Vibrio vulnificus (strain CMCP6) GN=folE PE=3 SV=1 100 304 1.0E-26
sp|Q87GZ6|GCH1_VIBPA GTP cyclohydrolase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=folE PE=3 SV=1 186 304 2.0E-26
sp|B1JQJ4|GCH1_YERPY GTP cyclohydrolase 1 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=folE PE=3 SV=1 117 307 3.0E-26
sp|A9R1B1|GCH1_YERPG GTP cyclohydrolase 1 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=folE PE=3 SV=1 117 307 3.0E-26
sp|Q8ZG15|GCH1_YERPE GTP cyclohydrolase 1 OS=Yersinia pestis GN=folE PE=3 SV=1 117 307 3.0E-26
sp|B2JZ02|GCH1_YERPB GTP cyclohydrolase 1 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=folE PE=3 SV=1 117 307 3.0E-26
sp|A7FJL1|GCH1_YERP3 GTP cyclohydrolase 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=folE PE=3 SV=1 117 307 3.0E-26
sp|A4WCI8|GCH1_ENT38 GTP cyclohydrolase 1 OS=Enterobacter sp. (strain 638) GN=folE PE=3 SV=1 132 307 2.0E-25
sp|B1YCT7|GCH1_PYRNV GTP cyclohydrolase 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=folE PE=3 SV=1 133 300 2.0E-25
sp|Q6LQL4|GCH1_PHOPR GTP cyclohydrolase 1 OS=Photobacterium profundum GN=folE PE=3 SV=1 104 304 2.0E-25
sp|A1REU0|GCH1_SHESW GTP cyclohydrolase 1 OS=Shewanella sp. (strain W3-18-1) GN=folE PE=3 SV=1 104 304 3.0E-25
sp|A4Y2K7|GCH1_SHEPC GTP cyclohydrolase 1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=folE PE=3 SV=1 104 304 3.0E-25
sp|Q8D2N7|GCH1_WIGBR GTP cyclohydrolase 1 OS=Wigglesworthia glossinidia brevipalpis GN=folE PE=3 SV=1 186 304 3.0E-25
sp|Q0HE51|GCH1_SHESM GTP cyclohydrolase 1 OS=Shewanella sp. (strain MR-4) GN=folE PE=3 SV=1 126 305 3.0E-25
sp|A0L1S4|GCH1_SHESA GTP cyclohydrolase 1 OS=Shewanella sp. (strain ANA-3) GN=folE PE=3 SV=1 126 305 3.0E-25
sp|Q0HZU8|GCH1_SHESR GTP cyclohydrolase 1 OS=Shewanella sp. (strain MR-7) GN=folE PE=3 SV=1 126 305 4.0E-25
sp|C4K3L4|GCH1_HAMD5 GTP cyclohydrolase 1 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=folE PE=3 SV=1 123 306 5.0E-25
sp|A9KXZ9|GCH1_SHEB9 GTP cyclohydrolase 1 OS=Shewanella baltica (strain OS195) GN=folE PE=3 SV=1 104 304 5.0E-25
sp|A6WIA1|GCH1_SHEB8 GTP cyclohydrolase 1 OS=Shewanella baltica (strain OS185) GN=folE PE=3 SV=1 104 304 5.0E-25
sp|A3CZJ1|GCH1_SHEB5 GTP cyclohydrolase 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=folE PE=3 SV=1 104 304 5.0E-25
sp|B8E4J0|GCH1_SHEB2 GTP cyclohydrolase 1 OS=Shewanella baltica (strain OS223) GN=folE PE=3 SV=1 104 304 5.0E-25
sp|Q7VRX3|GCH1_BLOFL GTP cyclohydrolase 1 OS=Blochmannia floridanus GN=folE PE=3 SV=1 187 304 5.0E-25
sp|A3QIQ4|GCH1_SHELP GTP cyclohydrolase 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=folE PE=3 SV=1 123 305 6.0E-25
sp|Q8E9L6|GCH1_SHEON GTP cyclohydrolase 1 OS=Shewanella oneidensis (strain MR-1) GN=folE PE=3 SV=1 104 304 8.0E-25
sp|Q2NUE3|GCH1_SODGM GTP cyclohydrolase 1 OS=Sodalis glossinidius (strain morsitans) GN=folE PE=3 SV=1 186 307 9.0E-25
sp|P64209|GCH1_SALTY GTP cyclohydrolase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=folE PE=3 SV=2 102 307 1.0E-24
sp|P64210|GCH1_SALTI GTP cyclohydrolase 1 OS=Salmonella typhi GN=folE PE=3 SV=2 102 307 1.0E-24
sp|B4TNQ0|GCH1_SALSV GTP cyclohydrolase 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|B5BE43|GCH1_SALPK GTP cyclohydrolase 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|C0Q0U7|GCH1_SALPC GTP cyclohydrolase 1 OS=Salmonella paratyphi C (strain RKS4594) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|A9N6K0|GCH1_SALPB GTP cyclohydrolase 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|Q5PE52|GCH1_SALPA GTP cyclohydrolase 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|B4SY26|GCH1_SALNS GTP cyclohydrolase 1 OS=Salmonella newport (strain SL254) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|B4TAL5|GCH1_SALHS GTP cyclohydrolase 1 OS=Salmonella heidelberg (strain SL476) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|B5R163|GCH1_SALEP GTP cyclohydrolase 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|B5FNJ7|GCH1_SALDC GTP cyclohydrolase 1 OS=Salmonella dublin (strain CT_02021853) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|A9MK63|GCH1_SALAR GTP cyclohydrolase 1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|B5EYP3|GCH1_SALA4 GTP cyclohydrolase 1 OS=Salmonella agona (strain SL483) GN=folE PE=3 SV=1 102 307 1.0E-24
sp|A8AE79|GCH1_CITK8 GTP cyclohydrolase 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=folE PE=3 SV=1 186 307 2.0E-24
sp|B6EGN8|GCH1_ALISL GTP cyclohydrolase 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=folE PE=3 SV=1 186 305 2.0E-24
sp|Q8ZWW5|GCH1_PYRAE GTP cyclohydrolase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=folE PE=3 SV=1 122 286 2.0E-24
sp|B5RC32|GCH1_SALG2 GTP cyclohydrolase 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=folE PE=3 SV=1 102 307 2.0E-24
sp|A6TBN8|GCH1_KLEP7 GTP cyclohydrolase 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|Q9SFV7|GCH1_ARATH GTP cyclohydrolase 1 OS=Arabidopsis thaliana GN=GCH1 PE=1 SV=1 130 270 3.0E-24
sp|Q3Z053|GCH1_SHISS GTP cyclohydrolase 1 OS=Shigella sonnei (strain Ss046) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|P0A6T8|GCH1_SHIFL GTP cyclohydrolase 1 OS=Shigella flexneri GN=folE PE=3 SV=2 186 307 3.0E-24
sp|Q0T2X1|GCH1_SHIF8 GTP cyclohydrolase 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|Q32EN8|GCH1_SHIDS GTP cyclohydrolase 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|Q31YW1|GCH1_SHIBS GTP cyclohydrolase 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B2TVT9|GCH1_SHIB3 GTP cyclohydrolase 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B7LVB3|GCH1_ESCF3 GTP cyclohydrolase 1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|Q1R9R9|GCH1_ECOUT GTP cyclohydrolase 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B1LKQ0|GCH1_ECOSM GTP cyclohydrolase 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B6I8K3|GCH1_ECOSE GTP cyclohydrolase 1 OS=Escherichia coli (strain SE11) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B7NCI3|GCH1_ECOLU GTP cyclohydrolase 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|P0A6T5|GCH1_ECOLI GTP cyclohydrolase 1 OS=Escherichia coli (strain K12) GN=folE PE=1 SV=2 186 307 3.0E-24
sp|B1IYB6|GCH1_ECOLC GTP cyclohydrolase 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|P0A6T6|GCH1_ECOL6 GTP cyclohydrolase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=folE PE=3 SV=2 186 307 3.0E-24
sp|Q0TFT7|GCH1_ECOL5 GTP cyclohydrolase 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|A1AD13|GCH1_ECOK1 GTP cyclohydrolase 1 OS=Escherichia coli O1:K1 / APEC GN=folE PE=3 SV=1 186 307 3.0E-24
sp|A8A214|GCH1_ECOHS GTP cyclohydrolase 1 OS=Escherichia coli O9:H4 (strain HS) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B1X7P1|GCH1_ECODH GTP cyclohydrolase 1 OS=Escherichia coli (strain K12 / DH10B) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|C4ZU03|GCH1_ECOBW GTP cyclohydrolase 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B7M4Z9|GCH1_ECO8A GTP cyclohydrolase 1 OS=Escherichia coli O8 (strain IAI1) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B7MXG6|GCH1_ECO81 GTP cyclohydrolase 1 OS=Escherichia coli O81 (strain ED1a) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B7NMB8|GCH1_ECO7I GTP cyclohydrolase 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B5YWU3|GCH1_ECO5E GTP cyclohydrolase 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|P0A6T7|GCH1_ECO57 GTP cyclohydrolase 1 OS=Escherichia coli O157:H7 GN=folE PE=3 SV=2 186 307 3.0E-24
sp|B7LAH4|GCH1_ECO55 GTP cyclohydrolase 1 OS=Escherichia coli (strain 55989 / EAEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B7MF66|GCH1_ECO45 GTP cyclohydrolase 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B7UFG9|GCH1_ECO27 GTP cyclohydrolase 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|A7ZNX6|GCH1_ECO24 GTP cyclohydrolase 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=folE PE=3 SV=1 186 307 3.0E-24
sp|B5FF36|GCH1_VIBFM GTP cyclohydrolase 1 OS=Vibrio fischeri (strain MJ11) GN=folE PE=3 SV=1 186 305 3.0E-24
sp|Q5E4E4|GCH1_VIBF1 GTP cyclohydrolase 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=folE PE=3 SV=1 186 305 3.0E-24
sp|Q57ME6|GCH1_SALCH GTP cyclohydrolase 1 OS=Salmonella choleraesuis (strain SC-B67) GN=folE PE=3 SV=1 102 307 5.0E-24
sp|B5XP57|GCH1_KLEP3 GTP cyclohydrolase 1 OS=Klebsiella pneumoniae (strain 342) GN=folE PE=3 SV=1 186 307 6.0E-24
sp|C6DEM6|GCH1_PECCP GTP cyclohydrolase 1 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=folE PE=3 SV=1 186 307 6.0E-24
sp|A8GC24|GCH1_SERP5 GTP cyclohydrolase 1 OS=Serratia proteamaculans (strain 568) GN=folE PE=3 SV=1 186 307 8.0E-24
sp|Q6D3N3|GCH1_PECAS GTP cyclohydrolase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=folE PE=3 SV=1 186 307 8.0E-24
sp|C5BCL9|GCH1_EDWI9 GTP cyclohydrolase 1 OS=Edwardsiella ictaluri (strain 93-146) GN=folE PE=3 SV=1 186 307 1.0E-23
sp|Q9SFV7|GCH1_ARATH GTP cyclohydrolase 1 OS=Arabidopsis thaliana GN=GCH1 PE=1 SV=1 130 304 2.0E-23
sp|A1S2C7|GCH1_SHEAM GTP cyclohydrolase 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=folE PE=3 SV=1 126 304 2.0E-23
sp|B2VII2|GCH1_ERWT9 GTP cyclohydrolase 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=folE PE=3 SV=1 104 304 2.0E-23
sp|Q12SG0|GCH1_SHEDO GTP cyclohydrolase 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=folE PE=3 SV=1 137 304 2.0E-23
sp|Q7N6K7|GCH1_PHOLL GTP cyclohydrolase 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=folE PE=3 SV=1 186 304 1.0E-22
sp|Q8XZK8|GCH1_RALSO GTP cyclohydrolase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=folE PE=3 SV=1 128 307 3.0E-22
sp|Q1LT77|GCH1_BAUCH GTP cyclohydrolase 1 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=folE PE=3 SV=1 186 304 2.0E-21
sp|Q7NYZ2|GCH1_CHRVO GTP cyclohydrolase 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=folE PE=3 SV=1 181 307 3.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3085
MVQLDKIQSAVNKRQPDDGCLTSSSSSSDSTRKRKRKHRASHGDSAIVSTPSSVSRPQAFDHRRSSLGKGARDPR
DKPPAKKRAHVAGQGQRVCPPSPVIDQDGLSRPSLGTRQRLEEDAEQASARLERMRGAVHTLLECIGEDPDREGL
RDSPARYAKALLFLTSGYQVNVEDIVNDALFHEGHNEMVIVKDIEIQSLCEHHLIPFIGKMHIGYIPSDTVIGIS
KLPRIAAMYARRLQIQERLTKEVAHAIMEILEPQGVAVVMESSHLCMVMRGVEQTASSTITSCVLGCFERKSKTR
NEFLSLVGLNRS*
Coding >OphauG2|3085
ATGGTACAGCTCGACAAGATCCAGTCGGCTGTCAATAAGCGTCAGCCTGATGATGGCTGCCTCACCAGCTCCTCA
AGCAGCTCCGACTCGACCCGCAAGCGCAAGCGCAAGCACCGTGCTTCTCACGGCGACTCGGCCATTGTTTCCACG
CCCTCGTCCGTCTCGCGGCCCCAGGCCTTTGACCATCGTCGCAGCAGCCTCGGCAAAGGCGCCCGCGATCCTAGA
GACAAACCCCCAGCAAAGAAGCGTGCTCACGTTGCCGGCCAGGGCCAGCGTGTTTGTCCGCCGAGTCCAGTCATT
GATCAAGATGGCCTTTCGCGACCGAGCCTCGGCACCCGCCAACGCCTCGAGGAAGATGCAGAACAGGCCTCTGCT
CGTCTTGAACGCATGCGCGGAGCCGTACATACCCTCCTCGAGTGCATTGGCGAGGATCCAGACCGCGAGGGCCTC
CGTGACTCTCCGGCTCGCTACGCAAAGGCTCTCTTGTTCCTTACTAGCGGTTACCAGGTCAATGTCGAAGACATT
GTCAACGATGCCCTCTTCCACGAAGGCCACAACGAGATGGTGATTGTCAAGGATATCGAGATTCAGAGTCTCTGC
GAACACCATCTTATTCCCTTTATTGGCAAGATGCACATTGGCTATATTCCTTCAGACACAGTCATTGGAATCTCA
AAGCTTCCTCGCATCGCTGCAATGTATGCCCGTCGCCTTCAGATTCAGGAACGCCTCACAAAAGAGGTGGCTCAC
GCCATTATGGAAATCCTCGAGCCCCAGGGCGTCGCCGTCGTCATGGAATCCTCACACCTTTGCATGGTGATGCGC
GGCGTCGAGCAGACTGCCAGCTCAACAATCACCAGCTGCGTGCTTGGCTGCTTTGAGCGCAAGTCCAAGACGCGC
AACGAGTTTCTGAGCCTCGTTGGCCTCAACCGATCTTGA
Transcript >OphauG2|3085
ATGGTACAGCTCGACAAGATCCAGTCGGCTGTCAATAAGCGTCAGCCTGATGATGGCTGCCTCACCAGCTCCTCA
AGCAGCTCCGACTCGACCCGCAAGCGCAAGCGCAAGCACCGTGCTTCTCACGGCGACTCGGCCATTGTTTCCACG
CCCTCGTCCGTCTCGCGGCCCCAGGCCTTTGACCATCGTCGCAGCAGCCTCGGCAAAGGCGCCCGCGATCCTAGA
GACAAACCCCCAGCAAAGAAGCGTGCTCACGTTGCCGGCCAGGGCCAGCGTGTTTGTCCGCCGAGTCCAGTCATT
GATCAAGATGGCCTTTCGCGACCGAGCCTCGGCACCCGCCAACGCCTCGAGGAAGATGCAGAACAGGCCTCTGCT
CGTCTTGAACGCATGCGCGGAGCCGTACATACCCTCCTCGAGTGCATTGGCGAGGATCCAGACCGCGAGGGCCTC
CGTGACTCTCCGGCTCGCTACGCAAAGGCTCTCTTGTTCCTTACTAGCGGTTACCAGGTCAATGTCGAAGACATT
GTCAACGATGCCCTCTTCCACGAAGGCCACAACGAGATGGTGATTGTCAAGGATATCGAGATTCAGAGTCTCTGC
GAACACCATCTTATTCCCTTTATTGGCAAGATGCACATTGGCTATATTCCTTCAGACACAGTCATTGGAATCTCA
AAGCTTCCTCGCATCGCTGCAATGTATGCCCGTCGCCTTCAGATTCAGGAACGCCTCACAAAAGAGGTGGCTCAC
GCCATTATGGAAATCCTCGAGCCCCAGGGCGTCGCCGTCGTCATGGAATCCTCACACCTTTGCATGGTGATGCGC
GGCGTCGAGCAGACTGCCAGCTCAACAATCACCAGCTGCGTGCTTGGCTGCTTTGAGCGCAAGTCCAAGACGCGC
AACGAGTTTCTGAGCCTCGTTGGCCTCAACCGATCTTGA
Gene >OphauG2|3085
ATGGTACAGCTCGACAAGATCCAGTCGGCTGTCAATAAGCGTCAGCCTGATGATGGCTGCCTCACCAGCTCCTCA
AGCAGCTCCGACTCGACCCGCAAGCGCAAGCGCAAGCACCGTGCTTCTCACGGCGACTCGGCCATTGTTTCCACG
CCCTCGTCCGTCTCGCGGCCCCAGGCCTTTGACCATCGTCGCAGCAGCCTCGGCAAAGGCGCCCGCGATCCTAGA
GACAAACCCCCAGCAAAGAAGCGTGCTCACGTTGCCGGCCAGGGCCAGCGTGTTTGTCCGCCGAGTCCAGTCATT
GATCAAGATGGCCTTTCGCGACCGAGTATGGACCCTCCTGCTTCTGTACCCCGTGGCTGTGACATTGTCCACTGA
CAGTCAATAATAGGCCTCGGCACCCGCCAACGCCTCGAGGAAGATGCAGAACAGGCCTCTGCTCGTCTTGAACGC
ATGCGCGGAGCCGTACATACCCTCCTCGAGTGCATTGGCGAGGATCCAGACCGCGAGGGCCTCCGTGACTCTCCG
GCTCGCTACGCAAAGGCTCTCTTGTTCCTTACTAGCGGTTACCAGGTCAATGTCGAAGACATTGTCAACGATGCC
CTCTTCCACGAAGGCCACAACGAGATGGTGATTGTCAAGGATATCGAGATTCAGAGTCTCTGCGAACACCATCTT
ATTCCCTTTATTGGCAAGGTACTTGTCCATCTCTCGCACTGTATTTGCAACTGGCGCTTTGCTGACTGCTCCTTC
AAGATGCACATTGGCTATATTCCTTCAGACACAGTCATTGGAATCTCAAAGCTTCCTCGCATCGCTGCAATGTAT
GCCCGTCGCCTTCAGATTCAGGAACGCCTCACAAAAGAGGTGGCTCACGCCATTATGGAAATCCTCGAGCCCCAG
GGCGTCGCCGTCGTCATGGAATCCTCACACCTTTGCATGGTGATGCGCGGCGTCGAGCAGACTGCCAGCTCAACA
ATCACCAGCTGCGTGCTTGGCTGCTTTGAGCGCAAGTCCAAGACGCGCAACGAGTTTCTGAGCCTCGTTGGCCTC
AACCGATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail