Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3083
Gene name
LocationContig_2269:93..989
Strand+
Gene length (bp)896
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07522 DRMBL DNA repair metallo-beta-lactamase 3.2E-05 84 116

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup864
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3083 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|984
Ophiocordyceps camponoti-floridani Ophcf2|01310
Ophiocordyceps camponoti-rufipedis Ophun1|5915
Ophiocordyceps kimflemingae Ophio5|1852
Ophiocordyceps subramaniannii Hirsu2|4872
Ophiocordyceps subramaniannii Hirsu2|9820

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3083
MLTGYMCANTPRPGCLTSNPSVRLHSCQFSHKCPVASNPAVVHIYPVVNDLSDAGLEQKGDLASLTSPSFSSSQP
TNQQHHGLPLVIRFPFSRHSSYPELCAFVDAFKPRDIWPCTANLEQWARQGISISSLFAPYSSGTHFAHDALIPS
LAPFSSPPCPNTCPASPPSQPSSNANAQTTDSAQTTIRPPLPPDSAQTTTPLYHPSSSQPHKRKHDDVDDSSQHS
STTSSIHPGHSLVRQDAYLSALASASGKQPSAPVTLLSVDGAHSAADEEL*
Coding >OphauG2|3083
ATGCTCACTGGCTACATGTGCGCCAACACGCCCCGTCCCGGCTGTCTAACCTCCAACCCCTCTGTCCGCTTGCAC
AGCTGCCAGTTCTCTCACAAGTGCCCCGTTGCCAGCAATCCTGCTGTTGTGCATATATACCCCGTTGTCAATGAC
TTGTCCGATGCTGGTTTGGAGCAAAAGGGAGACCTGGCCTCGCTCACATCTCCCAGCTTCTCATCCTCGCAACCC
ACAAACCAACAACATCATGGCCTTCCACTCGTCATCAGATTCCCTTTCTCGCGCCACTCGTCATACCCTGAGCTC
TGCGCCTTTGTCGACGCGTTTAAACCTCGCGATATATGGCCTTGTACTGCCAATCTTGAACAATGGGCTCGCCAA
GGAATCTCCATCTCCTCCCTCTTCGCCCCCTACTCCTCCGGCACCCACTTCGCCCACGACGCGCTAATCCCATCC
CTCGCCCCTTTTTCAAGCCCCCCATGCCCCAATACCTGCCCTGCGTCTCCGCCCTCGCAGCCCTCGTCAAACGCC
AATGCTCAAACAACAGACTCTGCTCAAACAACCATTCGCCCACCTCTCCCACCAGACTCTGCCCAAACAACCACC
CCCTTATATCATCCCTCTTCCTCTCAACCTCACAAACGCAAACACGACGATGTTGACGATTCTTCGCAACACTCC
TCCACCACTTCGTCTATTCACCCTGGCCACTCCCTCGTCCGCCAAGACGCCTATCTCTCTGCTCTCGCCTCCGCT
TCCGGCAAGCAGCCGTCGGCGCCCGTCACCTTGCTCTCTGTAGACGGGGCCCATTCTGCTGCTGATGAAGAGCTC
TAG
Transcript >OphauG2|3083
ATGCTCACTGGCTACATGTGCGCCAACACGCCCCGTCCCGGCTGTCTAACCTCCAACCCCTCTGTCCGCTTGCAC
AGCTGCCAGTTCTCTCACAAGTGCCCCGTTGCCAGCAATCCTGCTGTTGTGCATATATACCCCGTTGTCAATGAC
TTGTCCGATGCTGGTTTGGAGCAAAAGGGAGACCTGGCCTCGCTCACATCTCCCAGCTTCTCATCCTCGCAACCC
ACAAACCAACAACATCATGGCCTTCCACTCGTCATCAGATTCCCTTTCTCGCGCCACTCGTCATACCCTGAGCTC
TGCGCCTTTGTCGACGCGTTTAAACCTCGCGATATATGGCCTTGTACTGCCAATCTTGAACAATGGGCTCGCCAA
GGAATCTCCATCTCCTCCCTCTTCGCCCCCTACTCCTCCGGCACCCACTTCGCCCACGACGCGCTAATCCCATCC
CTCGCCCCTTTTTCAAGCCCCCCATGCCCCAATACCTGCCCTGCGTCTCCGCCCTCGCAGCCCTCGTCAAACGCC
AATGCTCAAACAACAGACTCTGCTCAAACAACCATTCGCCCACCTCTCCCACCAGACTCTGCCCAAACAACCACC
CCCTTATATCATCCCTCTTCCTCTCAACCTCACAAACGCAAACACGACGATGTTGACGATTCTTCGCAACACTCC
TCCACCACTTCGTCTATTCACCCTGGCCACTCCCTCGTCCGCCAAGACGCCTATCTCTCTGCTCTCGCCTCCGCT
TCCGGCAAGCAGCCGTCGGCGCCCGTCACCTTGCTCTCTGTAGACGGGGCCCATTCTGCTGCTGATGAAGAGCTC
TAG
Gene >OphauG2|3083
ATGCTCACTGGCTACATGTGCGCCAACACGCCCCGTCCCGGCTGTCTAACCTCCAACCCCTCTGTCCGCTTGCAC
AGCTGCCAGTTCTCTCACAAGTGCCCCGTTGCCAGCAATCCTGCTGTTGTGCATATATACCCCGTTGTCAATGAC
TTGTCCGATGCTGGTTTGGAGCAAAAGGGAGACCTGGCCTCGCTCACATCTCCCAGCTTCTCATCCTCGCAACCC
ACAAACCAACAACATCATGGCCTTCCACTCGTCATCAGATTCCCTTTCTCGCGCCACTCGTCATACCCTGAGCTC
TGCGCCTTTGTCGACGCGTTTAAACCTCGCGATATATGGCCTTGTACTGCCAATCTTGAACAATGGGCTCGCCAA
GGTAAAAAAAAAAAAAAATGCCTATACTTTTTTCTCATATCCCCCAGAATACCTAGCTAACCACTACAGGAATCT
CCATCTCCTCCCTCTTCGCCCCCTACTCCTCCGGCACCCACTTCGCCCACGACGCGCTAATCCCATCCCTCGCCC
CTTTTTCAAGCCCCCCATGCCCCAATACCTGCCCTGCGTCTCCGCCCTCGCAGCCCTCGTCAAACGCCAATGCTC
AAACAACAGACTCTGCTCAAACAACCATTCGCCCACCTCTCCCACCAGACTCTGCCCAAACAACCACCCCCTTAT
ATCATCCCTCTTCCTCTCAACCTCACAAACGCAAACACGACGATGTTGACGATTCTTCGCAACACTCCTCCACCA
CTTCGTCTATTCACCCTGGCCACTCCCTCGTCCGCCAAGACGCCTATCTCTCTGCTCTCGCCTCCGCTTCCGGCA
AGCAGCCGTCGGCGCCCGTCACCTTGCTCTCTGTAGACGGGGCCCATTCTGCTGCTGATGAAGAGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail