Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3074
Gene name
LocationContig_226:8359..10413
Strand-
Gene length (bp)2054
Transcript length (bp)1983
Coding sequence length (bp)1983
Protein length (aa) 661

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03068 PAD Protein-arginine deiminase (PAD) 2.4E-94 190 580

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P70708|PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus GN=Padi3 PE=2 SV=1 191 580 4.0E-36
sp|Q9ULC6|PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens GN=PADI1 PE=2 SV=2 188 580 7.0E-36
sp|Q9ULW8|PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens GN=PADI3 PE=1 SV=2 191 580 1.0E-35
sp|Q9Z184|PADI3_MOUSE Protein-arginine deiminase type-3 OS=Mus musculus GN=Padi3 PE=1 SV=2 191 580 2.0E-35
sp|O88806|PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus GN=Padi1 PE=2 SV=1 191 580 9.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P70708|PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus GN=Padi3 PE=2 SV=1 191 580 4.0E-36
sp|Q9ULC6|PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens GN=PADI1 PE=2 SV=2 188 580 7.0E-36
sp|Q9ULW8|PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens GN=PADI3 PE=1 SV=2 191 580 1.0E-35
sp|Q9Z184|PADI3_MOUSE Protein-arginine deiminase type-3 OS=Mus musculus GN=Padi3 PE=1 SV=2 191 580 2.0E-35
sp|O88806|PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus GN=Padi1 PE=2 SV=1 191 580 9.0E-35
sp|O02849|PADI3_SHEEP Protein-arginine deiminase type-3 OS=Ovis aries GN=PADI3 PE=1 SV=1 173 579 3.0E-34
sp|Q9Z185|PADI1_MOUSE Protein-arginine deiminase type-1 OS=Mus musculus GN=Padi1 PE=1 SV=1 191 580 3.0E-34
sp|Q9Y2J8|PADI2_HUMAN Protein-arginine deiminase type-2 OS=Homo sapiens GN=PADI2 PE=1 SV=2 191 580 2.0E-33
sp|P20717|PADI2_RAT Protein-arginine deiminase type-2 OS=Rattus norvegicus GN=Padi2 PE=1 SV=1 191 580 2.0E-32
sp|Q08642|PADI2_MOUSE Protein-arginine deiminase type-2 OS=Mus musculus GN=Padi2 PE=1 SV=2 191 580 2.0E-32
sp|Q9UM07|PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens GN=PADI4 PE=1 SV=2 192 580 4.0E-31
sp|O88807|PADI4_RAT Protein-arginine deiminase type-4 OS=Rattus norvegicus GN=Padi4 PE=2 SV=1 319 580 6.0E-29
sp|Q9Z183|PADI4_MOUSE Protein-arginine deiminase type-4 OS=Mus musculus GN=Padi4 PE=2 SV=3 192 580 7.0E-29
sp|Q6TGC4|PADI6_HUMAN Protein-arginine deiminase type-6 OS=Homo sapiens GN=PADI6 PE=1 SV=3 302 580 2.0E-24
sp|Q8K3V4|PADI6_MOUSE Protein-arginine deiminase type-6 OS=Mus musculus GN=Padi6 PE=1 SV=2 192 580 1.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005737 cytoplasm Yes
GO:0004668 protein-arginine deiminase activity Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines No
GO:0043167 ion binding No
GO:0005575 cellular_component No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3074
MRGSTALSFALTLAGVVAFQADIRADSNRDGKVSIDDSSDLGESKQTWTEESGAMFLPNIGDTMGRCRDLNSGNE
EALVKCNDASDDIQRAPQYLAPLKTVPIQDLGPGAVGKISVSDQAARSLVRVFRPKGDGWEIVTDETSFSAEELA
KGLELGIDARGPRGHKIDGTRLWDGRATVEFTVIDGETNSTDSVAMRVAPLLTQTHQQRAVKVFASSTLKSDNQM
LNQFQQIVKESGIEEPLHQVVGLTPFIQDLFETMYASIPGPDGAITSMPILLPAPANNYEWVTEAGGHVARQIRF
TGVGMVTDVVPDDDNQETLDSMGNLETIPPYEFNGKKYPAGRIVVGANETAGRVPLSVPFLQAQEMQDPLLVDST
WLEIQHVDEFLQFLPAKTSPRGWRVMVADPLGALKILQDAKADGYGNDSYSSRPLTGKTPVVSLEKYLSPTLIKT
NEECARRIQGTIDLLKRETGITDDDIMGVPVLYYKALDVQIPANGDFQVGAVYPNAINGLVLSDSAYVAPQQFGL
INGTGTDIMQHAVEEVYKKAGFDVKFVDDWEMHEIKGDVHCATNVIREIPAPWWQPGQPEASPPEASPKASPSEG
GQQMDPREREQKLCENIGKSLDECRPQVAECVFRARKEGITGQDEDETWKKIEECVKAVI*
Coding >OphauG2|3074
ATGAGAGGTTCAACCGCGCTGTCGTTCGCTTTAACATTGGCTGGGGTGGTGGCATTCCAGGCCGATATTCGCGCA
GATAGCAACCGCGATGGCAAGGTCTCTATTGACGACTCGTCAGACCTGGGCGAGAGCAAACAAACCTGGACTGAA
GAGTCGGGTGCCATGTTCCTCCCCAACATTGGCGATACCATGGGTCGATGTCGCGATCTGAACTCGGGTAATGAG
GAAGCACTCGTGAAATGCAACGACGCTTCCGACGACATCCAGCGAGCACCTCAGTACTTGGCCCCCTTGAAAACA
GTTCCCATCCAGGACCTTGGTCCGGGGGCGGTAGGCAAGATCTCCGTCTCGGACCAAGCAGCTCGTAGCCTTGTC
CGAGTATTTCGACCCAAAGGCGATGGCTGGGAGATTGTCACCGACGAGACAAGCTTTTCTGCCGAGGAACTTGCC
AAAGGACTAGAGCTCGGGATTGACGCCCGTGGCCCACGAGGCCATAAGATTGACGGAACTCGGCTCTGGGACGGC
AGAGCCACAGTTGAATTTACTGTAATTGATGGAGAGACAAACTCTACCGACTCGGTGGCGATGCGCGTGGCTCCG
CTCCTTACCCAGACTCACCAGCAACGCGCTGTCAAGGTTTTCGCCTCTTCGACTTTGAAATCCGATAACCAGATG
CTTAACCAATTTCAACAAATCGTCAAGGAGTCTGGAATCGAGGAGCCACTTCATCAAGTGGTGGGGTTGACGCCT
TTTATCCAAGACCTCTTCGAAACCATGTATGCTAGCATCCCCGGACCAGACGGCGCCATCACCAGCATGCCGATT
CTGCTCCCTGCACCGGCAAACAACTATGAATGGGTCACCGAGGCAGGCGGACACGTGGCTCGCCAAATTCGCTTC
ACTGGAGTTGGCATGGTCACCGATGTGGTGCCAGACGACGATAACCAGGAGACGCTGGACAGCATGGGAAATCTA
GAGACGATCCCGCCTTATGAATTCAACGGCAAGAAGTATCCTGCTGGAAGGATTGTCGTTGGCGCCAACGAGACG
GCTGGCAGAGTGCCCTTATCAGTGCCCTTTCTCCAGGCTCAGGAGATGCAGGATCCGTTGCTAGTAGATTCGACC
TGGCTCGAAATCCAGCACGTGGACGAGTTTCTCCAGTTTCTCCCAGCCAAAACATCACCTCGTGGATGGCGCGTC
ATGGTCGCCGACCCGCTAGGGGCTCTCAAGATCCTCCAGGACGCCAAGGCCGATGGCTACGGCAATGACAGCTAT
TCCAGCCGCCCACTGACCGGCAAAACCCCCGTTGTATCTCTCGAGAAGTATCTGAGTCCGACGCTCATAAAAACG
AATGAGGAGTGTGCGCGACGCATTCAGGGCACTATTGACCTGCTCAAGCGCGAGACTGGAATCACAGACGATGAT
ATCATGGGAGTTCCGGTGCTATACTATAAAGCTCTCGATGTGCAAATTCCAGCCAACGGAGACTTTCAAGTCGGT
GCCGTCTATCCCAACGCCATCAACGGCCTCGTCCTGTCCGACTCGGCATATGTGGCGCCGCAGCAATTTGGCCTG
ATAAACGGTACCGGCACGGATATCATGCAACATGCTGTGGAAGAGGTTTACAAAAAGGCCGGGTTCGACGTTAAA
TTTGTCGATGATTGGGAAATGCATGAGATCAAGGGAGATGTTCATTGTGCCACCAATGTCATCCGTGAGATTCCG
GCCCCTTGGTGGCAGCCCGGCCAGCCCGAGGCCAGCCCGCCCGAGGCCAGCCCAAAGGCCAGTCCATCAGAGGGA
GGCCAGCAGATGGACCCACGAGAGAGGGAGCAGAAGCTGTGTGAAAACATTGGCAAGAGCCTCGATGAGTGTCGC
CCTCAGGTCGCCGAGTGCGTTTTTAGGGCACGAAAGGAGGGAATCACGGGCCAAGACGAAGATGAAACGTGGAAG
AAGATTGAGGAATGCGTCAAGGCCGTTATATAG
Transcript >OphauG2|3074
ATGAGAGGTTCAACCGCGCTGTCGTTCGCTTTAACATTGGCTGGGGTGGTGGCATTCCAGGCCGATATTCGCGCA
GATAGCAACCGCGATGGCAAGGTCTCTATTGACGACTCGTCAGACCTGGGCGAGAGCAAACAAACCTGGACTGAA
GAGTCGGGTGCCATGTTCCTCCCCAACATTGGCGATACCATGGGTCGATGTCGCGATCTGAACTCGGGTAATGAG
GAAGCACTCGTGAAATGCAACGACGCTTCCGACGACATCCAGCGAGCACCTCAGTACTTGGCCCCCTTGAAAACA
GTTCCCATCCAGGACCTTGGTCCGGGGGCGGTAGGCAAGATCTCCGTCTCGGACCAAGCAGCTCGTAGCCTTGTC
CGAGTATTTCGACCCAAAGGCGATGGCTGGGAGATTGTCACCGACGAGACAAGCTTTTCTGCCGAGGAACTTGCC
AAAGGACTAGAGCTCGGGATTGACGCCCGTGGCCCACGAGGCCATAAGATTGACGGAACTCGGCTCTGGGACGGC
AGAGCCACAGTTGAATTTACTGTAATTGATGGAGAGACAAACTCTACCGACTCGGTGGCGATGCGCGTGGCTCCG
CTCCTTACCCAGACTCACCAGCAACGCGCTGTCAAGGTTTTCGCCTCTTCGACTTTGAAATCCGATAACCAGATG
CTTAACCAATTTCAACAAATCGTCAAGGAGTCTGGAATCGAGGAGCCACTTCATCAAGTGGTGGGGTTGACGCCT
TTTATCCAAGACCTCTTCGAAACCATGTATGCTAGCATCCCCGGACCAGACGGCGCCATCACCAGCATGCCGATT
CTGCTCCCTGCACCGGCAAACAACTATGAATGGGTCACCGAGGCAGGCGGACACGTGGCTCGCCAAATTCGCTTC
ACTGGAGTTGGCATGGTCACCGATGTGGTGCCAGACGACGATAACCAGGAGACGCTGGACAGCATGGGAAATCTA
GAGACGATCCCGCCTTATGAATTCAACGGCAAGAAGTATCCTGCTGGAAGGATTGTCGTTGGCGCCAACGAGACG
GCTGGCAGAGTGCCCTTATCAGTGCCCTTTCTCCAGGCTCAGGAGATGCAGGATCCGTTGCTAGTAGATTCGACC
TGGCTCGAAATCCAGCACGTGGACGAGTTTCTCCAGTTTCTCCCAGCCAAAACATCACCTCGTGGATGGCGCGTC
ATGGTCGCCGACCCGCTAGGGGCTCTCAAGATCCTCCAGGACGCCAAGGCCGATGGCTACGGCAATGACAGCTAT
TCCAGCCGCCCACTGACCGGCAAAACCCCCGTTGTATCTCTCGAGAAGTATCTGAGTCCGACGCTCATAAAAACG
AATGAGGAGTGTGCGCGACGCATTCAGGGCACTATTGACCTGCTCAAGCGCGAGACTGGAATCACAGACGATGAT
ATCATGGGAGTTCCGGTGCTATACTATAAAGCTCTCGATGTGCAAATTCCAGCCAACGGAGACTTTCAAGTCGGT
GCCGTCTATCCCAACGCCATCAACGGCCTCGTCCTGTCCGACTCGGCATATGTGGCGCCGCAGCAATTTGGCCTG
ATAAACGGTACCGGCACGGATATCATGCAACATGCTGTGGAAGAGGTTTACAAAAAGGCCGGGTTCGACGTTAAA
TTTGTCGATGATTGGGAAATGCATGAGATCAAGGGAGATGTTCATTGTGCCACCAATGTCATCCGTGAGATTCCG
GCCCCTTGGTGGCAGCCCGGCCAGCCCGAGGCCAGCCCGCCCGAGGCCAGCCCAAAGGCCAGTCCATCAGAGGGA
GGCCAGCAGATGGACCCACGAGAGAGGGAGCAGAAGCTGTGTGAAAACATTGGCAAGAGCCTCGATGAGTGTCGC
CCTCAGGTCGCCGAGTGCGTTTTTAGGGCACGAAAGGAGGGAATCACGGGCCAAGACGAAGATGAAACGTGGAAG
AAGATTGAGGAATGCGTCAAGGCCGTTATATAG
Gene >OphauG2|3074
ATGAGAGGTTCAACCGCGCTGTCGTTCGCTTTAAGTAAGACGCCCATGGTTCTTGGGGTTCTTGGTTCAGCTCAA
CGAATTGCTGACCTGCTTTTTCCCCCTTAGCATTGGCTGGGGTGGTGGCATTCCAGGCCGATATTCGCGCAGATA
GCAACCGCGATGGCAAGGTCTCTATTGACGACTCGTCAGACCTGGGCGAGAGCAAACAAACCTGGACTGAAGAGT
CGGGTGCCATGTTCCTCCCCAACATTGGCGATACCATGGGTCGATGTCGCGATCTGAACTCGGGTAATGAGGAAG
CACTCGTGAAATGCAACGACGCTTCCGACGACATCCAGCGAGCACCTCAGTACTTGGCCCCCTTGAAAACAGTTC
CCATCCAGGACCTTGGTCCGGGGGCGGTAGGCAAGATCTCCGTCTCGGACCAAGCAGCTCGTAGCCTTGTCCGAG
TATTTCGACCCAAAGGCGATGGCTGGGAGATTGTCACCGACGAGACAAGCTTTTCTGCCGAGGAACTTGCCAAAG
GACTAGAGCTCGGGATTGACGCCCGTGGCCCACGAGGCCATAAGATTGACGGAACTCGGCTCTGGGACGGCAGAG
CCACAGTTGAATTTACTGTAATTGATGGAGAGACAAACTCTACCGACTCGGTGGCGATGCGCGTGGCTCCGCTCC
TTACCCAGACTCACCAGCAACGCGCTGTCAAGGTTTTCGCCTCTTCGACTTTGAAATCCGATAACCAGATGCTTA
ACCAATTTCAACAAATCGTCAAGGAGTCTGGAATCGAGGAGCCACTTCATCAAGTGGTGGGGTTGACGCCTTTTA
TCCAAGACCTCTTCGAAACCATGTATGCTAGCATCCCCGGACCAGACGGCGCCATCACCAGCATGCCGATTCTGC
TCCCTGCACCGGCAAACAACTATGAATGGGTCACCGAGGCAGGCGGACACGTGGCTCGCCAAATTCGCTTCACTG
GAGTTGGCATGGTCACCGATGTGGTGCCAGACGACGATAACCAGGAGACGCTGGACAGCATGGGAAATCTAGAGA
CGATCCCGCCTTATGAATTCAACGGCAAGAAGTATCCTGCTGGAAGGATTGTCGTTGGCGCCAACGAGACGGCTG
GCAGAGTGCCCTTATCAGTGCCCTTTCTCCAGGCTCAGGAGATGCAGGATCCGTTGCTAGTAGATTCGACCTGGC
TCGAAATCCAGCACGTGGACGAGTTTCTCCAGTTTCTCCCAGCCAAAACATCACCTCGTGGATGGCGCGTCATGG
TCGCCGACCCGCTAGGGGCTCTCAAGATCCTCCAGGACGCCAAGGCCGATGGCTACGGCAATGACAGCTATTCCA
GCCGCCCACTGACCGGCAAAACCCCCGTTGTATCTCTCGAGAAGTATCTGAGTCCGACGCTCATAAAAACGAATG
AGGAGTGTGCGCGACGCATTCAGGGCACTATTGACCTGCTCAAGCGCGAGACTGGAATCACAGACGATGATATCA
TGGGAGTTCCGGTGCTATACTATAAAGCTCTCGATGTGCAAATTCCAGCCAACGGAGACTTTCAAGTCGGTGCCG
TCTATCCCAACGCCATCAACGGCCTCGTCCTGTCCGACTCGGCATATGTGGCGCCGCAGCAATTTGGCCTGATAA
ACGGTACCGGCACGGATATCATGCAACATGCTGTGGAAGAGGTTTACAAAAAGGCCGGGTTCGACGTTAAATTTG
TCGATGATTGGGAAATGCATGAGATCAAGGGAGATGTTCATTGTGCCACCAATGTCATCCGTGAGATTCCGGCCC
CTTGGTGGCAGCCCGGCCAGCCCGAGGCCAGCCCGCCCGAGGCCAGCCCAAAGGCCAGTCCATCAGAGGGAGGCC
AGCAGATGGACCCACGAGAGAGGGAGCAGAAGCTGTGTGAAAACATTGGCAAGAGCCTCGATGAGTGTCGCCCTC
AGGTCGCCGAGTGCGTTTTTAGGGCACGAAAGGAGGGAATCACGGGCCAAGACGAAGATGAAACGTGGAAGAAGA
TTGAGGAATGCGTCAAGGCCGTTATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail