Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3051
Gene name
LocationContig_224:5267..13469
Strand+
Gene length (bp)8202
Transcript length (bp)8001
Coding sequence length (bp)8001
Protein length (aa) 2667

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12074 Gcn1_N Generalcontrol nonderepressible 1 (Gcn1) N-terminal 1.3E-110 363 714
PF13513 HEAT_EZ HEAT-like repeat 5.5E-07 1484 1536
PF10274 ParcG Parkin co-regulated protein 3.2E-05 2232 2348

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN1 PE=1 SV=1 597 2664 0.0E+00
sp|Q10105|GCN1_SCHPO Translational activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn1 PE=3 SV=1 152 2657 0.0E+00
sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens GN=GCN1L1 PE=1 SV=6 682 2565 0.0E+00
sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostelium discoideum GN=gcn1l1 PE=3 SV=1 1004 2623 0.0E+00
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 1401 1706 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN1 PE=1 SV=1 597 2664 0.0E+00
sp|Q10105|GCN1_SCHPO Translational activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn1 PE=3 SV=1 152 2657 0.0E+00
sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens GN=GCN1L1 PE=1 SV=6 682 2565 0.0E+00
sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostelium discoideum GN=gcn1l1 PE=3 SV=1 1004 2623 0.0E+00
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 1401 1706 4.0E-25
sp|P25997|EF3_CANAL Elongation factor 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEF3 PE=1 SV=2 1348 1668 1.0E-19
sp|P29551|EF3_PNECA Elongation factor 3 OS=Pneumocystis carinii GN=TEF3 PE=3 SV=1 1403 1669 2.0E-19
sp|P16521|EF3A_YEAST Elongation factor 3A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF3 PE=1 SV=4 1427 1696 3.0E-17
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 1386 1656 5.0E-17
sp|P53978|EF3B_YEAST Elongation factor 3B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEF3 PE=1 SV=2 1427 1668 2.0E-15
sp|O93796|EF3_CANGA Elongation factor 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEF3 PE=3 SV=2 1427 1698 3.0E-15
sp|Q75EV6|EF3_ASHGO Elongation factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF3 PE=3 SV=2 1427 1668 4.0E-15
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN1 PE=1 SV=1 209 448 1.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3774
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3051 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|99
Ophiocordyceps camponoti-floridani Ophcf2|00897
Ophiocordyceps camponoti-rufipedis Ophun1|2378
Ophiocordyceps kimflemingae Ophio5|734
Ophiocordyceps subramaniannii Hirsu2|736

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3051
MTEAVVAGIQVPAAGKALASSSTIVRIAQLQQINDVLTRKPLDQELIPALLDLVFATHALYHDRESRFAVQACLV
SAILNATSSQSLAPLVKAMRQESKKPGIAASSAFVLMEWCSILMQNLASSPAWEHLASDILLTDADAVDKCLQPP
CRPSVVRSAMVATRRGFRKLLGSVASPDKCLDNIVSILTAKGTQSVAKHAPMLGILAGVCARQPALKPLLKSQKP
KFYEFYIREIVGSRSPVPDHVCRGLDDFFENFTTTDEVDKELMPAIEKSLLRSPEVALGGVLKSLVDSLPGDFDL
SQILQTRLLKPLLSNVKSSNPAIRIGAMAAYRAILAHSRDVGSLDPVVDEIATSLSSGKLTSPDHRISYAEMLES
ITQSRKSAEKASTSLAAVASKEGNEAALASETLALARTLTTVLQQDGEIPKAALDSIVKGLAEKKATSRRIWMLL
AGNTLQSLDSNKFTPGASAFAESVTPKLVANFDEVVSNAAAAAQNGLVVGAYILTSLALPLKEKFAASSIDSSLT
KTDVISQAMSLTPKHAFLLSPRIYSKLSVQVDLEWFCQALYSVGKSLDIKSDTKVALAWSEAMIYLISATGIPSR
VQQEASKSLTRLYAQSPRLISGFIIDGIWSYFEQDQSKEGDTKLDKSYLGHVLKSVCLEPNARVSLNVEVSTECL
EAQACALLVLARPELIPRCSWIDLCLRMGIDPGDLARRHLDNLFGEIEKRTSLDQRSDAIRKAAYQACSELAFVA
PGTVIPRLTDFIGHDLDANQLANIGPVEAAIFRTPKGTCFVDVLAKKSQDAVPNKNNKDYDILKWEEELRAQIQQ
KKGQQRKLNADETAKVNAQLKKESEIRESVGQVEAKLKRGIGIIEALTTGIPTDAALWLGHAVRLLLGVIDSGAS
LVIGDAASLAFVACSAKVTTRLGAIRPFIGAATLRNRGVALQQPYNDESLEELVTRVLYRLRFAGEQRPFDAVSL
IYSLPLILDVLRKGGVGEDDDDRDAQLVLAIEFLTFHTDVCENEAVPRSELLTVLIQSMETHAQHYKIIKDCFAD
ACRCIAPNMSQGELMVLAKGAIVPSASVRTTVLQSISAEVDMSDVGFSDEMWLACHDDLEENRELGKEIWEESGF
EVDSKVAMRMVPYLESKDSQLRRAAARALADCAQSHKSCLTELFPHLQAKYLELAKPKKQQLNEFGMPMKVDTSD
PWEARQGVATAFKELAPVLDKKEVDGLFDFLIGCGPLADKSDAVRGEMLDAALGATEIHGKKMIDELMDKFEKTL
EQPDKGNDASDRVNEAVIIMYGALARHLKQGDSKIPIVIERLLATLSTPSETVQYAIAECLPPLIRASMDKSSTY
FDRVLDELLNSKKYAMQRGAAYGLAGLVLGRGISALREYRIITTLKSAMDNKKEAHQREAALLAFELLSTVLGRL
SEPYVIQIMPQLLTGFGDSNPDVRDACLAAAKACFGKLSSYGVKQILPTLLLGLDDQQWRSKRGACDLLGAMAYL
DPNQLANSLPDIIPPLTGVLNDSHKEVRAAANRSLKRFGEVIQNPEIKGLVDILLKALSDPTKYTDEALDSLIKV
QFVHYLDAPSLALVSRILERGLSDRSNTKRKAAQVIGSLAHLTEKKDIVAHLPILVAGLKSAAVDPVPTTRATAS
RALGSLVEKLGEDALPDLIPGLMQTLKADTGAGDRLGSAQALSEVLAGLGTGRLEETLPTILQNVESPKAAVREG
FMSLFIFLPVCFGNSFANYLGRIIPPILAGLADDVESIRETALRAGRLLVKNFAVRAIDLLLPELERGLADDSYR
IRLSSVELVGDLLFNLVGIKAGSEGDEDPDQDIGKEAGASLKEVLGPEKRNKILSALYVCRCDTSGAVRSATIGV
WKVLVASPRTLKELVPTITQLVIRRLGSSNMEHKVIASNALGELIRKAGDGVLSSLLPTLEQGLQASTDSDAKQG
ICLALRELIASASPEALEDHEKTLISVVRTALTDSDEEVREAAAEAFDSLQQIVGKRAVDQVLPFLLNLLRSEHE
AQNALSALLTLLTETTRSNIILPNLIPTLTTPPITAFDAKALASLSQVAGAAMNRRLPGIINSLMENEVNCEQDD
LRAELSTSFDTVIQSIDDYDGLNTIMNVMLGLLKHEDHRKRAAAAHHLGNFFTAASVDYSSYDQDIVRSLLNSFD
DGDIKVVQEAVGALVVFTKKLKKEDLEALVVSTRQTLQRIGVAGANLRGFEVPKGVNAVLPIFLHGLMNGSSDSR
VQASLGISDIVDRTSEASLRPYVTQITGPLIRVVSERATEVKSAILVTLNNLLEKMPTALKPFLPQLQRTFAKSL
ADQSSEALRTRAAKALGTLIKYTPRVDPLIAELVTGSKTTDAGVKTAMLKALYEVISRAGANMGESSRSAVLALI
DMDADERDDAMTITNAKLLGALIKNVPQDAATTLLRNRVVTTQMTHSSVLALNAVLVESPDALLQGALADELPEL
LCQGMANKNVFIADNFILATGKVLLSSPPKSFDSTKKMFETLAKLIEPGNPTDSRRLALVITRTISRSNMDLVRP
HVPLLASPIFASVRDVVIPVKLAAEAAFVELFSVTDEESRVFDKFMAGPGADLPPNTKRSMGDYFKRVAMRLGAQ
ARERREAEGGQGGLGLSNDEQEDEKEIWSVGKAEAAGEVFS*
Coding >OphauG2|3051
ATGACTGAAGCCGTCGTCGCTGGCATCCAGGTGCCCGCAGCTGGAAAGGCGCTCGCCTCGTCGTCCACCATTGTC
CGCATCGCACAGCTCCAGCAGATCAACGATGTTTTGACCCGGAAACCGTTGGACCAGGAGCTGATTCCAGCTCTT
CTCGACCTGGTCTTTGCTACTCATGCCCTGTATCATGACCGCGAGTCTCGTTTTGCCGTCCAAGCATGTCTTGTT
TCCGCCATCTTGAATGCCACAAGCTCCCAGTCCCTGGCGCCCCTGGTCAAAGCCATGCGCCAGGAGAGCAAGAAG
CCTGGAATTGCTGCGTCGAGCGCCTTTGTTTTGATGGAGTGGTGCAGCATCTTGATGCAGAATCTGGCCAGCTCG
CCTGCCTGGGAGCATCTTGCAAGCGATATTCTTCTGACTGACGCCGATGCCGTCGACAAATGCCTACAGCCACCA
TGCCGGCCGAGCGTCGTCCGTTCCGCCATGGTTGCTACTCGAAGAGGATTCAGAAAGCTCTTGGGCTCCGTTGCC
TCACCCGATAAGTGCCTCGACAACATTGTTTCAATACTCACGGCCAAAGGCACCCAGTCTGTGGCCAAACACGCC
CCCATGCTCGGTATCCTTGCTGGAGTCTGTGCTCGCCAACCAGCTCTCAAGCCTCTGCTCAAATCACAAAAACCC
AAATTCTATGAATTCTACATTCGCGAAATCGTCGGCTCTCGATCACCAGTGCCTGACCATGTTTGTCGTGGCCTC
GATGACTTTTTTGAGAATTTCACAACCACAGACGAAGTCGACAAGGAATTAATGCCAGCCATTGAAAAGTCGTTG
CTGCGTTCTCCCGAAGTTGCACTGGGCGGTGTTCTCAAGTCTTTGGTAGATTCACTGCCGGGAGACTTTGACCTA
TCCCAGATACTTCAAACAAGGCTCCTCAAGCCTCTCTTGTCCAACGTCAAGTCTAGCAATCCTGCCATCCGCATC
GGGGCCATGGCAGCCTATCGTGCTATTTTAGCGCATAGCCGCGACGTTGGCTCTTTGGACCCAGTCGTCGACGAG
ATTGCGACTTCCCTCTCCTCAGGAAAACTTACTTCTCCTGACCATAGGATCTCTTACGCCGAGATGCTTGAATCC
ATTACCCAGTCTAGAAAGTCTGCCGAAAAGGCGTCTACATCTCTCGCAGCAGTGGCATCAAAGGAGGGTAACGAA
GCAGCATTAGCCTCAGAGACATTGGCTCTTGCGCGTACCTTGACCACGGTGCTTCAGCAAGACGGCGAAATCCCA
AAAGCTGCACTGGATTCCATTGTCAAAGGTCTGGCTGAAAAGAAGGCAACTTCCCGCCGAATCTGGATGCTCTTG
GCCGGAAACACCCTGCAGTCTTTGGACAGCAACAAGTTTACGCCAGGCGCCTCTGCATTTGCAGAGAGTGTGACG
CCTAAGCTCGTGGCCAATTTTGATGAGGTCGTATCAAACGCTGCTGCCGCTGCTCAAAATGGCTTGGTCGTTGGC
GCCTATATTCTCACATCATTGGCGCTCCCTCTGAAGGAGAAATTTGCTGCCTCGTCTATTGATTCCTCCCTTACA
AAGACTGACGTTATATCTCAAGCAATGTCATTGACTCCAAAGCATGCGTTTCTCCTGAGTCCCCGCATATACAGC
AAGCTGAGTGTCCAGGTGGATTTGGAATGGTTCTGTCAGGCATTGTACTCTGTTGGGAAGAGTTTGGATATAAAA
TCGGACACTAAAGTGGCACTGGCCTGGTCAGAGGCCATGATTTATCTCATCAGTGCAACTGGCATCCCTTCAAGG
GTACAACAGGAAGCTTCCAAATCGCTTACCCGACTTTATGCTCAAAGCCCTCGTCTAATTTCTGGCTTCATCATT
GATGGCATATGGAGCTACTTTGAACAAGACCAGTCTAAAGAAGGCGATACGAAGCTGGACAAGTCATACCTGGGA
CACGTCTTGAAATCGGTTTGTCTCGAGCCTAACGCGCGTGTCTCGCTGAATGTCGAGGTATCTACTGAATGCCTG
GAAGCCCAAGCCTGCGCCTTGCTAGTTTTGGCGCGTCCGGAACTCATACCTCGATGTAGCTGGATAGACCTGTGT
CTCAGGATGGGCATTGATCCTGGCGACCTTGCACGCCGCCATCTGGACAATCTTTTTGGAGAAATCGAAAAGAGA
ACGTCCTTGGACCAGAGGTCCGACGCCATCAGAAAAGCCGCGTATCAGGCGTGTTCAGAACTGGCTTTTGTTGCT
CCCGGAACGGTCATACCACGATTGACAGACTTCATTGGCCATGATCTCGACGCGAATCAGCTTGCCAATATTGGG
CCGGTGGAAGCCGCAATCTTTAGAACGCCCAAAGGGACCTGCTTCGTTGATGTCCTTGCCAAAAAGAGCCAAGAT
GCTGTCCCCAATAAAAACAACAAGGACTACGATATTCTTAAATGGGAAGAGGAGCTAAGGGCTCAAATTCAACAA
AAGAAGGGGCAGCAGCGAAAGCTGAATGCGGATGAGACAGCAAAGGTCAATGCCCAACTCAAAAAAGAGTCTGAA
ATACGGGAGTCTGTTGGACAAGTCGAGGCAAAATTGAAACGCGGCATTGGCATTATCGAAGCTCTGACCACGGGC
ATACCAACGGATGCAGCTCTGTGGCTAGGACATGCAGTTAGATTGCTGCTTGGTGTCATTGACTCGGGGGCCAGC
CTTGTGATAGGTGACGCTGCCTCTTTAGCCTTTGTCGCCTGTTCAGCCAAGGTGACTACCAGGTTGGGCGCAATT
CGACCCTTTATTGGCGCAGCGACGCTGAGGAACCGAGGAGTTGCGCTCCAACAACCCTACAACGATGAGTCTTTG
GAGGAACTCGTTACAAGAGTCCTCTACCGTCTACGGTTCGCCGGCGAGCAACGCCCATTTGACGCAGTTTCACTC
ATATACTCGCTGCCCCTGATTCTCGACGTGTTGCGCAAAGGCGGAGTGGGCGAAGACGATGATGATCGAGACGCA
CAGCTCGTCTTGGCTATCGAGTTTCTCACCTTCCACACAGACGTCTGCGAGAACGAGGCAGTTCCTCGCTCAGAG
CTGCTGACAGTGCTCATCCAGTCCATGGAGACTCATGCTCAGCACTACAAGATTATCAAGGACTGCTTTGCAGAC
GCCTGTCGCTGCATAGCACCCAACATGAGCCAGGGCGAGCTGATGGTTCTGGCCAAGGGCGCAATCGTGCCGTCG
GCCAGCGTCAGAACGACTGTGTTGCAGTCCATCAGTGCCGAGGTTGACATGAGTGATGTCGGCTTCTCAGACGAG
ATGTGGCTGGCATGCCACGACGATTTGGAGGAGAATCGGGAACTCGGCAAAGAGATCTGGGAGGAAAGCGGCTTC
GAGGTGGATTCCAAAGTTGCCATGCGCATGGTGCCGTATCTGGAGAGCAAGGACTCGCAACTGCGCCGAGCAGCA
GCTCGTGCTCTGGCAGACTGTGCGCAGTCTCACAAATCATGCCTGACAGAGCTGTTTCCTCACTTGCAAGCCAAG
TATCTCGAGCTGGCCAAGCCAAAGAAGCAGCAGCTCAACGAGTTTGGCATGCCCATGAAAGTGGACACATCGGAC
CCCTGGGAAGCCAGACAAGGAGTTGCGACGGCTTTCAAGGAACTTGCTCCCGTCTTGGATAAGAAGGAGGTTGAT
GGCCTCTTTGACTTTTTGATAGGATGCGGCCCCCTAGCTGACAAGAGCGACGCTGTCCGTGGAGAAATGCTCGAC
GCTGCTCTGGGAGCTACCGAGATTCATGGCAAGAAAATGATTGATGAGCTGATGGACAAATTCGAAAAGACTCTG
GAGCAGCCAGACAAGGGCAACGACGCGTCGGACCGCGTCAATGAAGCCGTCATCATTATGTACGGAGCCCTGGCG
CGCCACTTGAAGCAGGGCGACTCCAAGATCCCCATTGTCATTGAACGGCTATTGGCGACTCTCAGCACCCCGTCC
GAGACGGTGCAGTATGCCATTGCCGAATGCTTGCCTCCGCTCATCAGGGCCAGCATGGACAAGTCTTCGACGTAC
TTTGACCGCGTCCTCGACGAGTTGCTCAACTCCAAAAAGTACGCCATGCAGAGAGGAGCAGCCTATGGCCTGGCT
GGACTGGTCCTCGGCAGAGGCATATCGGCTCTCCGCGAATACCGAATCATCACAACATTGAAGAGTGCCATGGAC
AACAAGAAGGAGGCGCATCAACGCGAAGCTGCCTTGCTTGCCTTTGAGCTCCTGTCGACGGTTCTCGGGCGTCTC
TCTGAGCCATATGTGATTCAAATCATGCCTCAATTACTCACTGGCTTTGGTGACAGCAACCCCGATGTTCGCGAT
GCCTGTCTTGCAGCAGCAAAGGCGTGCTTTGGTAAGCTGAGCTCGTACGGCGTCAAACAAATCCTCCCGACTCTG
CTGCTTGGCCTGGATGACCAGCAGTGGCGCAGCAAGCGAGGAGCCTGTGACCTCTTGGGCGCCATGGCCTATCTA
GACCCCAATCAACTGGCAAACAGCCTTCCAGACATCATTCCGCCCCTGACAGGAGTCCTCAATGACAGCCACAAG
GAAGTGCGGGCAGCAGCAAACCGCAGTTTGAAGCGGTTCGGCGAAGTCATCCAAAACCCCGAGATCAAGGGACTG
GTGGATATACTGCTCAAGGCGCTCAGCGATCCCACAAAGTATACCGACGAGGCTCTGGACTCACTCATTAAGGTG
CAGTTTGTTCATTATCTCGATGCCCCTTCACTAGCCCTTGTCAGTCGCATTCTGGAACGAGGTCTAAGCGATCGC
TCCAACACCAAGCGCAAGGCGGCCCAAGTCATTGGCAGTCTGGCCCATTTGACGGAGAAGAAGGACATTGTTGCC
CACTTGCCTATTCTGGTTGCTGGGCTCAAGTCTGCTGCTGTTGATCCAGTGCCTACAACGCGAGCCACGGCCTCT
AGGGCCCTGGGCTCCTTGGTGGAGAAGCTTGGCGAAGACGCTCTGCCCGACCTGATTCCCGGCTTGATGCAGACG
CTCAAGGCAGATACAGGCGCCGGCGATCGACTTGGCTCTGCACAGGCCCTGAGCGAGGTGCTTGCTGGTCTCGGG
ACCGGCAGACTGGAGGAAACGCTGCCGACGATTCTGCAAAACGTCGAGTCTCCCAAGGCAGCGGTTCGCGAAGGG
TTCATGTCACTCTTCATCTTCTTGCCCGTCTGCTTCGGCAACAGCTTCGCCAACTACCTGGGCCGCATCATTCCT
CCAATCCTGGCAGGGCTGGCGGATGATGTCGAGTCTATTCGCGAGACAGCTCTTCGAGCTGGTCGTCTGCTTGTC
AAAAACTTTGCCGTCCGCGCCATTGATCTTCTTCTCCCCGAACTGGAGCGCGGACTGGCTGATGACAGCTATCGG
ATCCGTCTCAGCTCGGTTGAACTTGTTGGCGATTTACTCTTCAACCTGGTGGGCATCAAGGCTGGCTCAGAGGGC
GACGAAGACCCGGACCAAGACATTGGCAAAGAAGCAGGAGCCTCTCTCAAGGAGGTTCTTGGCCCGGAAAAGCGC
AACAAGATTCTTTCAGCGCTCTATGTGTGCCGTTGCGACACTTCTGGCGCAGTACGGTCTGCAACCATTGGTGTA
TGGAAAGTCTTGGTTGCCAGTCCAAGAACTCTCAAGGAGCTTGTCCCAACCATTACACAGCTGGTCATTAGGCGG
CTAGGCAGCTCCAACATGGAACACAAGGTGATTGCCAGCAATGCTCTGGGCGAACTAATCCGCAAAGCCGGAGAC
GGCGTCCTCTCCAGCCTCTTGCCTACCCTGGAGCAAGGCCTGCAGGCTTCCACCGACTCGGATGCCAAGCAAGGC
ATCTGTCTTGCCCTTCGCGAACTCATTGCTTCGGCATCTCCTGAAGCCCTCGAAGACCACGAAAAGACACTTATA
TCCGTGGTGCGCACGGCCTTGACCGACTCGGACGAAGAGGTCAGAGAAGCCGCTGCCGAGGCCTTTGATTCGCTT
CAGCAGATTGTAGGCAAGCGTGCCGTCGATCAAGTTCTTCCCTTCCTTCTCAATCTCTTGCGCTCGGAACACGAG
GCCCAGAATGCCCTGTCGGCGCTACTCACTCTGCTCACTGAGACGACGCGCTCCAACATTATTCTGCCCAACCTC
ATTCCCACTTTGACGACCCCTCCCATCACCGCCTTTGACGCCAAGGCTTTGGCCTCTCTTTCTCAGGTGGCGGGA
GCTGCCATGAATCGCCGGTTGCCTGGCATCATCAACTCTCTCATGGAAAATGAAGTCAACTGCGAGCAAGACGAC
CTCAGGGCAGAGCTTTCAACATCGTTTGATACCGTCATACAGTCCATCGACGACTATGACGGCCTCAACACGATA
ATGAATGTCATGCTCGGCCTGCTCAAGCACGAGGATCACCGCAAGAGAGCGGCTGCAGCGCATCATCTCGGCAAT
TTCTTCACGGCAGCATCTGTTGACTACTCGTCATACGACCAAGACATTGTACGCTCTTTACTAAACTCTTTTGAC
GACGGCGACATCAAGGTTGTTCAAGAAGCGGTGGGAGCGCTCGTCGTCTTCACCAAGAAGCTGAAGAAGGAGGAT
CTGGAAGCGCTCGTCGTATCCACCAGGCAAACCCTGCAGCGCATTGGGGTCGCAGGCGCAAATCTGCGCGGCTTC
GAGGTTCCCAAGGGCGTCAATGCTGTCTTGCCCATCTTCCTGCATGGTCTGATGAATGGGTCGTCGGACAGCAGA
GTTCAGGCGTCGCTGGGCATCTCGGACATTGTCGACCGGACAAGCGAGGCGTCACTCAGGCCCTACGTGACCCAA
ATCACAGGTCCGCTCATTCGCGTCGTGTCTGAGCGCGCCACTGAAGTCAAGTCGGCAATTCTTGTAACGCTCAAC
AACCTGCTGGAGAAAATGCCCACGGCGTTGAAACCCTTTTTGCCACAGCTTCAGCGGACCTTTGCCAAGTCATTG
GCCGACCAGTCGAGCGAGGCGCTGCGCACCAGAGCTGCCAAGGCACTTGGCACGCTCATCAAGTATACGCCTCGC
GTTGACCCTCTGATTGCAGAATTGGTCACTGGGTCCAAGACTACTGATGCGGGTGTCAAGACGGCAATGCTCAAG
GCTCTGTACGAGGTGATAAGCAGGGCAGGGGCCAACATGGGAGAGTCATCTCGGTCTGCTGTGCTGGCTCTGATT
GACATGGATGCTGATGAGAGGGACGACGCCATGACCATTACCAACGCCAAGCTTCTGGGTGCTCTGATTAAGAAC
GTGCCCCAGGATGCGGCCACGACACTACTACGGAATCGCGTGGTGACGACCCAAATGACTCACTCGTCGGTACTT
GCGCTCAATGCAGTGCTTGTCGAGTCTCCAGACGCTTTGTTACAAGGCGCCTTGGCCGACGAACTGCCTGAACTA
CTCTGCCAGGGCATGGCCAACAAGAATGTCTTTATTGCCGACAACTTTATCCTGGCCACGGGCAAGGTCTTGCTC
TCTTCTCCACCAAAGAGTTTCGATAGCACCAAGAAGATGTTTGAAACGTTGGCCAAGCTCATTGAGCCTGGCAAC
CCCACCGACTCTCGACGGTTAGCCTTGGTAATAACTCGCACGATTAGCCGGTCAAACATGGACTTGGTCCGACCT
CATGTGCCGCTGCTCGCATCGCCTATATTCGCCAGCGTGAGAGACGTGGTCATTCCAGTCAAGCTGGCAGCCGAG
GCGGCCTTTGTTGAGCTCTTTAGCGTTACAGACGAAGAGAGTCGTGTGTTTGACAAATTTATGGCAGGTCCAGGG
GCAGACTTGCCGCCCAACACAAAGAGAAGCATGGGGGATTATTTTAAGCGGGTTGCAATGAGGCTTGGAGCACAG
GCGAGGGAGAGGAGAGAGGCAGAGGGTGGGCAGGGCGGATTGGGCTTATCAAATGATGAGCAGGAAGACGAAAAG
GAGATTTGGAGCGTGGGCAAGGCTGAAGCCGCGGGGGAAGTCTTTTCGTGA
Transcript >OphauG2|3051
ATGACTGAAGCCGTCGTCGCTGGCATCCAGGTGCCCGCAGCTGGAAAGGCGCTCGCCTCGTCGTCCACCATTGTC
CGCATCGCACAGCTCCAGCAGATCAACGATGTTTTGACCCGGAAACCGTTGGACCAGGAGCTGATTCCAGCTCTT
CTCGACCTGGTCTTTGCTACTCATGCCCTGTATCATGACCGCGAGTCTCGTTTTGCCGTCCAAGCATGTCTTGTT
TCCGCCATCTTGAATGCCACAAGCTCCCAGTCCCTGGCGCCCCTGGTCAAAGCCATGCGCCAGGAGAGCAAGAAG
CCTGGAATTGCTGCGTCGAGCGCCTTTGTTTTGATGGAGTGGTGCAGCATCTTGATGCAGAATCTGGCCAGCTCG
CCTGCCTGGGAGCATCTTGCAAGCGATATTCTTCTGACTGACGCCGATGCCGTCGACAAATGCCTACAGCCACCA
TGCCGGCCGAGCGTCGTCCGTTCCGCCATGGTTGCTACTCGAAGAGGATTCAGAAAGCTCTTGGGCTCCGTTGCC
TCACCCGATAAGTGCCTCGACAACATTGTTTCAATACTCACGGCCAAAGGCACCCAGTCTGTGGCCAAACACGCC
CCCATGCTCGGTATCCTTGCTGGAGTCTGTGCTCGCCAACCAGCTCTCAAGCCTCTGCTCAAATCACAAAAACCC
AAATTCTATGAATTCTACATTCGCGAAATCGTCGGCTCTCGATCACCAGTGCCTGACCATGTTTGTCGTGGCCTC
GATGACTTTTTTGAGAATTTCACAACCACAGACGAAGTCGACAAGGAATTAATGCCAGCCATTGAAAAGTCGTTG
CTGCGTTCTCCCGAAGTTGCACTGGGCGGTGTTCTCAAGTCTTTGGTAGATTCACTGCCGGGAGACTTTGACCTA
TCCCAGATACTTCAAACAAGGCTCCTCAAGCCTCTCTTGTCCAACGTCAAGTCTAGCAATCCTGCCATCCGCATC
GGGGCCATGGCAGCCTATCGTGCTATTTTAGCGCATAGCCGCGACGTTGGCTCTTTGGACCCAGTCGTCGACGAG
ATTGCGACTTCCCTCTCCTCAGGAAAACTTACTTCTCCTGACCATAGGATCTCTTACGCCGAGATGCTTGAATCC
ATTACCCAGTCTAGAAAGTCTGCCGAAAAGGCGTCTACATCTCTCGCAGCAGTGGCATCAAAGGAGGGTAACGAA
GCAGCATTAGCCTCAGAGACATTGGCTCTTGCGCGTACCTTGACCACGGTGCTTCAGCAAGACGGCGAAATCCCA
AAAGCTGCACTGGATTCCATTGTCAAAGGTCTGGCTGAAAAGAAGGCAACTTCCCGCCGAATCTGGATGCTCTTG
GCCGGAAACACCCTGCAGTCTTTGGACAGCAACAAGTTTACGCCAGGCGCCTCTGCATTTGCAGAGAGTGTGACG
CCTAAGCTCGTGGCCAATTTTGATGAGGTCGTATCAAACGCTGCTGCCGCTGCTCAAAATGGCTTGGTCGTTGGC
GCCTATATTCTCACATCATTGGCGCTCCCTCTGAAGGAGAAATTTGCTGCCTCGTCTATTGATTCCTCCCTTACA
AAGACTGACGTTATATCTCAAGCAATGTCATTGACTCCAAAGCATGCGTTTCTCCTGAGTCCCCGCATATACAGC
AAGCTGAGTGTCCAGGTGGATTTGGAATGGTTCTGTCAGGCATTGTACTCTGTTGGGAAGAGTTTGGATATAAAA
TCGGACACTAAAGTGGCACTGGCCTGGTCAGAGGCCATGATTTATCTCATCAGTGCAACTGGCATCCCTTCAAGG
GTACAACAGGAAGCTTCCAAATCGCTTACCCGACTTTATGCTCAAAGCCCTCGTCTAATTTCTGGCTTCATCATT
GATGGCATATGGAGCTACTTTGAACAAGACCAGTCTAAAGAAGGCGATACGAAGCTGGACAAGTCATACCTGGGA
CACGTCTTGAAATCGGTTTGTCTCGAGCCTAACGCGCGTGTCTCGCTGAATGTCGAGGTATCTACTGAATGCCTG
GAAGCCCAAGCCTGCGCCTTGCTAGTTTTGGCGCGTCCGGAACTCATACCTCGATGTAGCTGGATAGACCTGTGT
CTCAGGATGGGCATTGATCCTGGCGACCTTGCACGCCGCCATCTGGACAATCTTTTTGGAGAAATCGAAAAGAGA
ACGTCCTTGGACCAGAGGTCCGACGCCATCAGAAAAGCCGCGTATCAGGCGTGTTCAGAACTGGCTTTTGTTGCT
CCCGGAACGGTCATACCACGATTGACAGACTTCATTGGCCATGATCTCGACGCGAATCAGCTTGCCAATATTGGG
CCGGTGGAAGCCGCAATCTTTAGAACGCCCAAAGGGACCTGCTTCGTTGATGTCCTTGCCAAAAAGAGCCAAGAT
GCTGTCCCCAATAAAAACAACAAGGACTACGATATTCTTAAATGGGAAGAGGAGCTAAGGGCTCAAATTCAACAA
AAGAAGGGGCAGCAGCGAAAGCTGAATGCGGATGAGACAGCAAAGGTCAATGCCCAACTCAAAAAAGAGTCTGAA
ATACGGGAGTCTGTTGGACAAGTCGAGGCAAAATTGAAACGCGGCATTGGCATTATCGAAGCTCTGACCACGGGC
ATACCAACGGATGCAGCTCTGTGGCTAGGACATGCAGTTAGATTGCTGCTTGGTGTCATTGACTCGGGGGCCAGC
CTTGTGATAGGTGACGCTGCCTCTTTAGCCTTTGTCGCCTGTTCAGCCAAGGTGACTACCAGGTTGGGCGCAATT
CGACCCTTTATTGGCGCAGCGACGCTGAGGAACCGAGGAGTTGCGCTCCAACAACCCTACAACGATGAGTCTTTG
GAGGAACTCGTTACAAGAGTCCTCTACCGTCTACGGTTCGCCGGCGAGCAACGCCCATTTGACGCAGTTTCACTC
ATATACTCGCTGCCCCTGATTCTCGACGTGTTGCGCAAAGGCGGAGTGGGCGAAGACGATGATGATCGAGACGCA
CAGCTCGTCTTGGCTATCGAGTTTCTCACCTTCCACACAGACGTCTGCGAGAACGAGGCAGTTCCTCGCTCAGAG
CTGCTGACAGTGCTCATCCAGTCCATGGAGACTCATGCTCAGCACTACAAGATTATCAAGGACTGCTTTGCAGAC
GCCTGTCGCTGCATAGCACCCAACATGAGCCAGGGCGAGCTGATGGTTCTGGCCAAGGGCGCAATCGTGCCGTCG
GCCAGCGTCAGAACGACTGTGTTGCAGTCCATCAGTGCCGAGGTTGACATGAGTGATGTCGGCTTCTCAGACGAG
ATGTGGCTGGCATGCCACGACGATTTGGAGGAGAATCGGGAACTCGGCAAAGAGATCTGGGAGGAAAGCGGCTTC
GAGGTGGATTCCAAAGTTGCCATGCGCATGGTGCCGTATCTGGAGAGCAAGGACTCGCAACTGCGCCGAGCAGCA
GCTCGTGCTCTGGCAGACTGTGCGCAGTCTCACAAATCATGCCTGACAGAGCTGTTTCCTCACTTGCAAGCCAAG
TATCTCGAGCTGGCCAAGCCAAAGAAGCAGCAGCTCAACGAGTTTGGCATGCCCATGAAAGTGGACACATCGGAC
CCCTGGGAAGCCAGACAAGGAGTTGCGACGGCTTTCAAGGAACTTGCTCCCGTCTTGGATAAGAAGGAGGTTGAT
GGCCTCTTTGACTTTTTGATAGGATGCGGCCCCCTAGCTGACAAGAGCGACGCTGTCCGTGGAGAAATGCTCGAC
GCTGCTCTGGGAGCTACCGAGATTCATGGCAAGAAAATGATTGATGAGCTGATGGACAAATTCGAAAAGACTCTG
GAGCAGCCAGACAAGGGCAACGACGCGTCGGACCGCGTCAATGAAGCCGTCATCATTATGTACGGAGCCCTGGCG
CGCCACTTGAAGCAGGGCGACTCCAAGATCCCCATTGTCATTGAACGGCTATTGGCGACTCTCAGCACCCCGTCC
GAGACGGTGCAGTATGCCATTGCCGAATGCTTGCCTCCGCTCATCAGGGCCAGCATGGACAAGTCTTCGACGTAC
TTTGACCGCGTCCTCGACGAGTTGCTCAACTCCAAAAAGTACGCCATGCAGAGAGGAGCAGCCTATGGCCTGGCT
GGACTGGTCCTCGGCAGAGGCATATCGGCTCTCCGCGAATACCGAATCATCACAACATTGAAGAGTGCCATGGAC
AACAAGAAGGAGGCGCATCAACGCGAAGCTGCCTTGCTTGCCTTTGAGCTCCTGTCGACGGTTCTCGGGCGTCTC
TCTGAGCCATATGTGATTCAAATCATGCCTCAATTACTCACTGGCTTTGGTGACAGCAACCCCGATGTTCGCGAT
GCCTGTCTTGCAGCAGCAAAGGCGTGCTTTGGTAAGCTGAGCTCGTACGGCGTCAAACAAATCCTCCCGACTCTG
CTGCTTGGCCTGGATGACCAGCAGTGGCGCAGCAAGCGAGGAGCCTGTGACCTCTTGGGCGCCATGGCCTATCTA
GACCCCAATCAACTGGCAAACAGCCTTCCAGACATCATTCCGCCCCTGACAGGAGTCCTCAATGACAGCCACAAG
GAAGTGCGGGCAGCAGCAAACCGCAGTTTGAAGCGGTTCGGCGAAGTCATCCAAAACCCCGAGATCAAGGGACTG
GTGGATATACTGCTCAAGGCGCTCAGCGATCCCACAAAGTATACCGACGAGGCTCTGGACTCACTCATTAAGGTG
CAGTTTGTTCATTATCTCGATGCCCCTTCACTAGCCCTTGTCAGTCGCATTCTGGAACGAGGTCTAAGCGATCGC
TCCAACACCAAGCGCAAGGCGGCCCAAGTCATTGGCAGTCTGGCCCATTTGACGGAGAAGAAGGACATTGTTGCC
CACTTGCCTATTCTGGTTGCTGGGCTCAAGTCTGCTGCTGTTGATCCAGTGCCTACAACGCGAGCCACGGCCTCT
AGGGCCCTGGGCTCCTTGGTGGAGAAGCTTGGCGAAGACGCTCTGCCCGACCTGATTCCCGGCTTGATGCAGACG
CTCAAGGCAGATACAGGCGCCGGCGATCGACTTGGCTCTGCACAGGCCCTGAGCGAGGTGCTTGCTGGTCTCGGG
ACCGGCAGACTGGAGGAAACGCTGCCGACGATTCTGCAAAACGTCGAGTCTCCCAAGGCAGCGGTTCGCGAAGGG
TTCATGTCACTCTTCATCTTCTTGCCCGTCTGCTTCGGCAACAGCTTCGCCAACTACCTGGGCCGCATCATTCCT
CCAATCCTGGCAGGGCTGGCGGATGATGTCGAGTCTATTCGCGAGACAGCTCTTCGAGCTGGTCGTCTGCTTGTC
AAAAACTTTGCCGTCCGCGCCATTGATCTTCTTCTCCCCGAACTGGAGCGCGGACTGGCTGATGACAGCTATCGG
ATCCGTCTCAGCTCGGTTGAACTTGTTGGCGATTTACTCTTCAACCTGGTGGGCATCAAGGCTGGCTCAGAGGGC
GACGAAGACCCGGACCAAGACATTGGCAAAGAAGCAGGAGCCTCTCTCAAGGAGGTTCTTGGCCCGGAAAAGCGC
AACAAGATTCTTTCAGCGCTCTATGTGTGCCGTTGCGACACTTCTGGCGCAGTACGGTCTGCAACCATTGGTGTA
TGGAAAGTCTTGGTTGCCAGTCCAAGAACTCTCAAGGAGCTTGTCCCAACCATTACACAGCTGGTCATTAGGCGG
CTAGGCAGCTCCAACATGGAACACAAGGTGATTGCCAGCAATGCTCTGGGCGAACTAATCCGCAAAGCCGGAGAC
GGCGTCCTCTCCAGCCTCTTGCCTACCCTGGAGCAAGGCCTGCAGGCTTCCACCGACTCGGATGCCAAGCAAGGC
ATCTGTCTTGCCCTTCGCGAACTCATTGCTTCGGCATCTCCTGAAGCCCTCGAAGACCACGAAAAGACACTTATA
TCCGTGGTGCGCACGGCCTTGACCGACTCGGACGAAGAGGTCAGAGAAGCCGCTGCCGAGGCCTTTGATTCGCTT
CAGCAGATTGTAGGCAAGCGTGCCGTCGATCAAGTTCTTCCCTTCCTTCTCAATCTCTTGCGCTCGGAACACGAG
GCCCAGAATGCCCTGTCGGCGCTACTCACTCTGCTCACTGAGACGACGCGCTCCAACATTATTCTGCCCAACCTC
ATTCCCACTTTGACGACCCCTCCCATCACCGCCTTTGACGCCAAGGCTTTGGCCTCTCTTTCTCAGGTGGCGGGA
GCTGCCATGAATCGCCGGTTGCCTGGCATCATCAACTCTCTCATGGAAAATGAAGTCAACTGCGAGCAAGACGAC
CTCAGGGCAGAGCTTTCAACATCGTTTGATACCGTCATACAGTCCATCGACGACTATGACGGCCTCAACACGATA
ATGAATGTCATGCTCGGCCTGCTCAAGCACGAGGATCACCGCAAGAGAGCGGCTGCAGCGCATCATCTCGGCAAT
TTCTTCACGGCAGCATCTGTTGACTACTCGTCATACGACCAAGACATTGTACGCTCTTTACTAAACTCTTTTGAC
GACGGCGACATCAAGGTTGTTCAAGAAGCGGTGGGAGCGCTCGTCGTCTTCACCAAGAAGCTGAAGAAGGAGGAT
CTGGAAGCGCTCGTCGTATCCACCAGGCAAACCCTGCAGCGCATTGGGGTCGCAGGCGCAAATCTGCGCGGCTTC
GAGGTTCCCAAGGGCGTCAATGCTGTCTTGCCCATCTTCCTGCATGGTCTGATGAATGGGTCGTCGGACAGCAGA
GTTCAGGCGTCGCTGGGCATCTCGGACATTGTCGACCGGACAAGCGAGGCGTCACTCAGGCCCTACGTGACCCAA
ATCACAGGTCCGCTCATTCGCGTCGTGTCTGAGCGCGCCACTGAAGTCAAGTCGGCAATTCTTGTAACGCTCAAC
AACCTGCTGGAGAAAATGCCCACGGCGTTGAAACCCTTTTTGCCACAGCTTCAGCGGACCTTTGCCAAGTCATTG
GCCGACCAGTCGAGCGAGGCGCTGCGCACCAGAGCTGCCAAGGCACTTGGCACGCTCATCAAGTATACGCCTCGC
GTTGACCCTCTGATTGCAGAATTGGTCACTGGGTCCAAGACTACTGATGCGGGTGTCAAGACGGCAATGCTCAAG
GCTCTGTACGAGGTGATAAGCAGGGCAGGGGCCAACATGGGAGAGTCATCTCGGTCTGCTGTGCTGGCTCTGATT
GACATGGATGCTGATGAGAGGGACGACGCCATGACCATTACCAACGCCAAGCTTCTGGGTGCTCTGATTAAGAAC
GTGCCCCAGGATGCGGCCACGACACTACTACGGAATCGCGTGGTGACGACCCAAATGACTCACTCGTCGGTACTT
GCGCTCAATGCAGTGCTTGTCGAGTCTCCAGACGCTTTGTTACAAGGCGCCTTGGCCGACGAACTGCCTGAACTA
CTCTGCCAGGGCATGGCCAACAAGAATGTCTTTATTGCCGACAACTTTATCCTGGCCACGGGCAAGGTCTTGCTC
TCTTCTCCACCAAAGAGTTTCGATAGCACCAAGAAGATGTTTGAAACGTTGGCCAAGCTCATTGAGCCTGGCAAC
CCCACCGACTCTCGACGGTTAGCCTTGGTAATAACTCGCACGATTAGCCGGTCAAACATGGACTTGGTCCGACCT
CATGTGCCGCTGCTCGCATCGCCTATATTCGCCAGCGTGAGAGACGTGGTCATTCCAGTCAAGCTGGCAGCCGAG
GCGGCCTTTGTTGAGCTCTTTAGCGTTACAGACGAAGAGAGTCGTGTGTTTGACAAATTTATGGCAGGTCCAGGG
GCAGACTTGCCGCCCAACACAAAGAGAAGCATGGGGGATTATTTTAAGCGGGTTGCAATGAGGCTTGGAGCACAG
GCGAGGGAGAGGAGAGAGGCAGAGGGTGGGCAGGGCGGATTGGGCTTATCAAATGATGAGCAGGAAGACGAAAAG
GAGATTTGGAGCGTGGGCAAGGCTGAAGCCGCGGGGGAAGTCTTTTCGTGA
Gene >OphauG2|3051
ATGACTGAAGCCGTCGTCGCTGGCATCCAGGTGCCCGCAGCTGGAAAGGCGCTCGCCTCGTCGTCCACCATTGTC
CGCATCGCACAGCTCCAGCAGATCAACGATGTTTTGACCCGGAAACGTAAGCATCAAGTCTTCTGTGCCAGATTT
GCGCCCACCCTATACTGACTGGCTGTGCTGCCAGCGTTGGACCAGGAGCTGATTCCAGCTCTTCTCGACCTGGTC
TTTGCTACTCATGCCCTGTATCATGACCGCGAGTCTCGTTTTGCCGTCCAAGCATGTCTTGTTTCCGCCATCTTG
AATGCCACAAGCTCCCAGTCCCTGGCGCCCCTGGTCAAAGCCATGCGCCAGGAGAGCAAGAAGCCTGGAATTGCT
GCGTCGAGCGCCTTTGTTTTGATGGAGTGGTGCAGCATCTTGATGCAGAATCTGGCCAGCTCGCCTGCCTGGGAG
CATCTTGCAAGCGATATTCTTCTGACTGACGCCGATGCCGTCGACAAATGCCTACAGCCACCATGCCGGCCGAGC
GTCGTCCGTTCCGCCATGGTTGCTACTCGAAGAGGATTCAGAAAGCTCTTGGGCTCCGTTGCCTCACCCGATAAG
TGCCTCGACAACATTGTTTCAATACTCACGGCCAAAGGCACCCAGTCTGTGGCCAAACACGCCCCCATGCTCGGT
ATCCTTGCTGGAGTCTGTGCTCGCCAACCAGCTCTCAAGCCTCTGCTCAAATCACAAAAACCCAAATTCTATGAA
TTCTACATTCGCGAAATCGTCGGCTCTCGATCACCAGTGCCTGACCATGTTTGTCGTGGCCTCGATGACTTTTTT
GAGAATTTCACAACCACAGACGAAGTCGACAAGGAATTAATGCCAGCCATTGAAAAGTCGTTGCTGCGTTCTCCC
GAAGTTGCACTGGGCGGTGTTCTCAAGTCTTTGGTAGATTCACTGCCGGGAGACTTTGACCTATCCCAGATACTT
CAAACAAGGCTCCTCAAGCCTCTCTTGTCCAACGTCAAGTCTAGCAATCCTGCCATCCGCATCGGGGCCATGGCA
GCCTATCGTGCTATTTTAGCGCATAGCCGCGACGTTGGCTCTTTGGACCCAGTCGTCGACGAGATTGCGACTTCC
CTCTCCTCAGGAAAACTTACTTCTCCTGACCATAGGATCTCTTACGCCGAGATGCTTGAATCCATTACCCAGTCT
AGAAAGTCTGCCGAAAAGGCGTCTACATCTCTCGCAGCAGTGGCATCAAAGGAGGGTAACGAAGCAGCATTAGCC
TCAGAGACATTGGCTCTTGCGCGTACCTTGACCACGGTGCTTCAGCAAGACGGCGAAATCCCAAAAGCTGCACTG
GATTCCATTGTCAAAGGTCTGGCTGAAAAGAAGGCAACTTCCCGCCGAATCTGGATGCTCTTGGCCGGAAACACC
CTGCAGTCTTTGGACAGCAACAAGTTTACGCCAGGCGCCTCTGCATTTGCAGAGAGTGTGACGCCTAAGCTCGTG
GCCAATTTTGATGAGGTCGTATCAAACGCTGCTGCCGCTGCTCAAAATGGCTTGGTCGTTGGCGCCTATATTCTC
ACATCATTGGCGCTCCCTCTGAAGGAGAAATTTGCTGCCTCGTCTATTGATTCCTCCCTTACAAAGACTGACGTT
ATATCTCAAGCAATGTCATTGACTCCAAAGCATGCGTTTCTCCTGAGTCCCCGCATATACAGCAAGCTGAGTGTC
CAGGTGGATTTGGAATGGTTCTGTCAGGCATTGTACTCTGTTGGGAAGAGTTTGGATATAAAATCGGACACTAAA
GTGGCACTGGCCTGGTCAGAGGCCATGATTTATCTCATCAGTGCAACTGGCATCCCTTCAAGGGTACAACAGGAA
GCTTCCAAATCGCTTACCCGACTTTATGCTCAAAGCCCTCGTCTAATTTCTGGCTTCATCATTGATGGCATATGG
AGCTACTTTGAACAAGACCAGTCTAAAGAAGGCGATACGAAGCTGGACAAGTCATACCTGGGACACGTCTTGAAA
TCGGTTTGTCTCGAGCCTAACGCGCGTGTCTCGCTGAATGTCGAGGTATCTACTGAATGCCTGGAAGCCCAAGCC
TGCGCCTTGCTAGTTTTGGCGCGTCCGGAACTCATACCTCGATGTAGCTGGATAGACCTGTGTCTCAGGATGGGC
ATTGATCCTGGCGACCTTGCACGCCGCCATCTGGACAATCTTTTTGGAGAAATCGAAAAGAGAACGTCCTTGGAC
CAGAGGGTAAGCAAATGAAGCAACAGACCTGCATTCTCTGCCATGCTTGGCTACCTTGACTGACCACTCTTTTGT
TGGCCAGTCCGACGCCATCAGAAAAGCCGCGTATCAGGCGTGTTCAGAACTGGCTTTTGTTGCTCCCGGAACGGT
CATACCACGATTGACAGACTTCATTGGCCATGATCTCGACGCGAATCAGCTTGCCAATATTGGGCCGGTGGAAGC
CGCAATCTTTAGAACGCCCAAAGGGACCTGCTTCGTTGATGTCCTTGCCAAAAAGAGCCAAGATGCTGTCCCCAA
TAAAAACAACAAGGACTACGATATTCTTAAATGGGAAGAGGAGCTAAGGGCTCAAATTCAACAAAAGAAGGGGCA
GCAGCGAAAGCTGAATGCGGATGAGACAGCAAAGGTCAATGCCCAACTCAAAAAAGAGTCTGAAATACGGGAGTC
TGTTGGACAAGTCGAGGCAAAATTGAAACGCGGCATTGGCATTATCGAAGCTCTGACCACGGGCATACCAACGGA
TGCAGCTCTGTGGCTAGGACATGCAGTTAGATTGCTGCTTGGTGTCATTGACTCGGGGGCCAGCCTTGTGATAGG
TGACGCTGCCTCTTTAGCCTTTGTCGCCTGTTCAGCCAAGGTGACTACCAGGTTGGGCGCAATTCGACCCTTTAT
TGGCGCAGCGACGCTGAGGAACCGAGGAGTTGCGCTCCAACAACCCTACAACGATGAGTCTTTGGAGGAACTCGT
TACAAGAGTCCTCTACCGTCTACGGTTCGCCGGCGAGCAACGCCCATTTGACGCAGTTTCACTCATATACTCGCT
GCCCCTGATTCTCGACGTGTTGCGCAAAGGCGGAGTGGGCGAAGACGATGATGATCGAGACGCACAGCTCGTCTT
GGCTATCGAGTTTCTCACCTTCCACACAGACGTCTGCGAGAACGAGGCAGTTCCTCGCTCAGAGCTGCTGACAGT
GCTCATCCAGTCCATGGAGACTCATGCTCAGCACTACAAGATTATCAAGGACTGCTTTGCAGACGCCTGTCGCTG
CATAGCACCCAACATGAGCCAGGGCGAGCTGATGGTTCTGGCCAAGGGCGCAATCGTGCCGTCGGCCAGCGTCAG
AACGACTGTGTTGCAGTCCATCAGTGCCGAGGTTGACATGAGTGATGTCGGCTTCTCAGACGAGATGTGGCTGGC
ATGCCACGACGATTTGGAGGAGAATCGGGAACTCGGCAAAGAGATCTGGGAGGAAAGCGGCTTCGAGGTGGATTC
CAAAGTTGCCATGCGCATGGTGCCGTATCTGGAGAGCAAGGACTCGCAACTGCGCCGAGCAGCAGCTCGTGCTCT
GGCAGACTGTGCGCAGTCTCACAAATCATGCCTGACAGAGCTGTTTCCTCACTTGCAAGCCAAGTATCTCGAGCT
GGCCAAGCCAAAGAAGCAGCAGCTCAACGAGTTTGGCATGCCCATGAAAGTGGACACATCGGACCCCTGGGAAGC
CAGACAAGGAGTTGCGACGGCTTTCAAGGAACTTGCTCCCGTCTTGGATAAGAAGGAGGTTGATGGCCTCTTTGA
CTTTTTGATAGGATGCGGCCCCCTAGCTGACAAGAGCGACGCTGTCCGTGGAGAAATGCTCGACGCTGCTCTGGG
AGCTACCGAGATTCATGGCAAGAAAATGATTGATGAGCTGATGGACAAATTCGAAAAGACTCTGGAGCAGCCAGA
CAAGGGCAACGACGCGTCGGACCGCGTCAATGAAGCCGTCATCATTATGTACGGAGCCCTGGCGCGCCACTTGAA
GCAGGGCGACTCCAAGATCCCCATTGTCATTGAACGGCTATTGGCGACTCTCAGCACCCCGTCCGAGACGGTGCA
GTATGCCATTGCCGAATGCTTGCCTCCGCTCATCAGGGCCAGCATGGACAAGTCTTCGACGTACTTTGACCGCGT
CCTCGACGAGTTGCTCAACTCCAAAAAGTACGCCATGCAGAGAGGAGCAGCCTATGGCCTGGCTGGACTGGTCCT
CGGCAGAGGCATATCGGCTCTCCGCGAATACCGAATCATCACAACATTGAAGAGTGCCATGGACAACAAGAAGGA
GGCGCATCAACGCGAAGCTGCCTTGCTTGCCTTTGAGCTCCTGTCGACGGTTCTCGGGCGTCTCTCTGAGCCATA
TGTGATTCAAATCATGCCTCAATTACTCACTGGCTTTGGTGACAGCAACCCCGATGTTCGCGATGCCTGTCTTGC
AGCAGCAAAGGCGTGCTTTGGTAAGCTGAGCTCGTACGGCGTCAAACAAATCCTCCCGACTCTGCTGCTTGGCCT
GGATGACCAGCAGTGGCGCAGCAAGCGAGGAGCCTGTGACCTCTTGGGCGCCATGGCCTATCTAGACCCCAATCA
ACTGGCAAACAGCCTTCCAGACATCATTCCGCCCCTGACAGGAGTCCTCAATGACAGCCACAAGGAAGTGCGGGC
AGCAGCAAACCGCAGTTTGAAGCGGTTCGGCGAAGTCATCCAAAACCCCGAGATCAAGGGACTGGTGGATATACT
GCTCAAGGCGCTCAGCGATCCCACAAAGTATACCGACGAGGCTCTGGACTCACTCATTAAGGTGCAGTTTGTTCA
TTATCTCGATGCCCCTTCACTAGCCCTTGTCAGTCGCATTCTGGAACGAGGTCTAAGCGATCGCTCCAACACCAA
GCGCAAGGCGGCCCAAGTCATTGGCAGTCTGGCCCATTTGACGGAGAAGAAGGACATTGTTGCCCACTTGCCTAT
TCTGGTTGCTGGGCTCAAGTCTGCTGCTGTTGATCCAGTGCCTACAACGCGAGCCACGGCCTCTAGGGCCCTGGG
CTCCTTGGTGGAGAAGCTTGGCGAAGACGCTCTGCCCGACCTGATTCCCGGCTTGATGCAGACGCTCAAGGCAGA
TACAGGCGCCGGCGATCGACTTGGCTCTGCACAGGCCCTGAGCGAGGTGCTTGCTGGTCTCGGGACCGGCAGACT
GGAGGAAACGCTGCCGACGATTCTGCAAAACGTCGAGTCTCCCAAGGCAGCGGTTCGCGAAGGGTTCATGTCACT
CTTCATCTTCTTGCCCGTCTGCTTCGGCAACAGCTTCGCCAACTACCTGGGCCGCATCATTCCTCCAATCCTGGC
AGGGCTGGCGGATGATGTCGAGTCTATTCGCGAGACAGCTCTTCGAGCTGGTCGTCTGCTTGTCAAAAACTTTGC
CGTCCGCGCCATTGATCTTCTTCTCCCCGAACTGGAGCGCGGACTGGCTGATGACAGCTATCGGATCCGTCTCAG
CTCGGTTGAACTTGTTGGCGATTTACTCTTCAACCTGGTGGGCATCAAGGCTGGCTCAGAGGGCGACGAAGACCC
GGACCAAGACATTGGCAAAGAAGCAGGAGCCTCTCTCAAGGAGGTTCTTGGCCCGGAAAAGCGCAACAAGATTCT
TTCAGCGCTCTATGTGTGCCGTTGCGACACTTCTGGCGCAGTACGGTCTGCAACCATTGGTGTATGGAAAGTCTT
GGTTGCCAGTCCAAGAACTCTCAAGGAGCTTGTCCCAACCATTACACAGCTGGTCATTAGGCGGCTAGGCAGCTC
CAACATGGAACACAAGGTGATTGCCAGCAATGCTCTGGGCGAACTAATCCGCAAAGCCGGAGACGGCGTCCTCTC
CAGCCTCTTGCCTACCCTGGAGCAAGGCCTGCAGGCTTCCACCGACTCGGATGCCAAGCAAGGCATCTGTCTTGC
CCTTCGCGAACTCATTGCTTCGGCATCTCCTGAAGCCCTCGAAGACCACGAAAAGACACTTATATCCGTGGTGCG
CACGGCCTTGACCGACTCGGACGAAGAGGTCAGAGAAGCCGCTGCCGAGGCCTTTGATTCGCTTCAGCAGATTGT
AGGCAAGCGTGCCGTCGATCAAGTTCTTCCCTTCCTTCTCAATCTCTTGCGCTCGGAACACGAGGCCCAGAATGC
CCTGTCGGCGCTACTCACTCTGCTCACTGAGACGACGCGCTCCAACATTATTCTGCCCAACCTCATTCCCACTTT
GACGACCCCTCCCATCACCGCCTTTGACGCCAAGGCTTTGGCCTCTCTTTCTCAGGTGGCGGGAGCTGCCATGAA
TCGCCGGTTGCCTGGCATCATCAACTCTCTCATGGAAAATGAAGTCAACTGCGAGCAAGACGACCTCAGGGCAGA
GCTTTCAACATCGTTTGATACCGTCATACAGTCCATCGACGACTATGACGGCCTCAACACGATAATGAATGTCAT
GCTCGGCCTGCTCAAGCACGAGGATCACCGCAAGAGAGCGGCTGCAGCGCATCATCTCGGCAATTTCTTCACGGC
AGCATCTGTTGACTACTCGTCATACGACCAAGACATTGTACGCTCTTTACTAAACTCTTTTGACGACGGCGACAT
CAAGGTTGTTCAAGAAGCGGTGGGAGCGCTCGTCGTCTTCACCAAGAAGCTGAAGAAGGAGGATCTGGAAGCGCT
CGTCGTATCCACCAGGCAAACCCTGCAGCGCATTGGGGTCGCAGGCGCAAATCTGCGCGGCTTCGAGGTTCCCAA
GGGCGTCAATGCTGTCTTGCCCATCTTCCTGCATGGTCTGATGAATGGGTCGTCGGACAGCAGAGTTCAGGCGTC
GCTGGGCATCTCGGACATTGTCGACCGGACAAGCGAGGCGTCACTCAGGCCCTACGTGACCCAAATCACAGGTCC
GCTCATTCGCGTCGTGTCTGAGCGCGCCACTGAAGTCAAGTCGGCAATTCTTGTAACGCTCAACAACCTGCTGGA
GAAAATGCCCACGGCGTTGAAACCCTTTTTGCCACAGCTTCAGCGGACCTTTGCCAAGTCATTGGCCGACCAGTC
GAGCGAGGCGCTGCGCACCAGAGCTGCCAAGGCACTTGGCACGCTCATCAAGTATACGCCTCGCGTTGACCCTCT
GATTGCAGAATTGGTCACTGGGTCCAAGACTACTGATGCGGGTGTCAAGACGGCAATGCTCAAGGCTCTGTACGA
GGTGATAAGCAGGGCAGGGGCCAACATGGGAGAGTCATCTCGGTCTGCTGTGCTGGCTCTGATTGACATGGATGC
TGATGAGAGGGACGACGCCATGACCATTACCAACGCCAAGCTTCTGGGTGCTCTGATTAAGAACGTGCCCCAGGA
TGCGGCCACGACACTACTACGGAATCGCGTGGTGACGACCCAAATGACTCACTCGTCGGTACTTGCGCTCAATGC
AGTGCTTGTCGAGTCTCCAGACGCTTTGTTACAAGGCGCCTTGGCCGACGAACTGCCTGAACTACTCTGCCAGGG
CATGGCCAACAAGAATGTAAGTTTAGTAGGGTCCGTCCAATAATGTGCAAAGCAGACAAGGCTAAACTGTGAATA
CAGGTCTTTATTGCCGACAACTTTATCCTGGCCACGGGCAAGGTCTTGCTCTCTTCTCCACCAAAGAGTTTCGAT
AGCACCAAGAAGATGTTTGAAACGTTGGCCAAGCTCATTGAGCCTGGCAACCCCACCGACTCTCGACGGTTAGCC
TTGGTAATAACTCGCACGATTAGCCGGTCAAACATGGACTTGGTCCGACCTCATGTGCCGCTGCTCGCATCGCCT
ATATTCGCCAGCGTGAGAGACGTGGTCATTCCAGTCAAGCTGGCAGCCGAGGCGGCCTTTGTTGAGCTCTTTAGC
GTTACAGACGAAGAGAGTCGTGTGTTTGACAAATTTATGGCAGGTCCAGGGGCAGACTTGCCGCCCAACACAAAG
AGAAGCATGGGGGATTATTTTAAGCGGGTTGCAATGAGGCTTGGAGCACAGGCGAGGGAGAGGAGAGAGGCAGAG
GGTGGGCAGGGCGGATTGGGCTTATCAAATGATGAGCAGGAAGACGAAAAGGAGATTTGGAGCGTGGGCAAGGCT
GAAGCCGCGGGGGAAGTCTTTTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail