Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3047
Gene name
LocationContig_223:16792..19313
Strand-
Gene length (bp)2521
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 5.3E-57 166 374
PF03836 RasGAP_C RasGAP C-terminus 2.6E-28 553 672

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 31 749 0.0E+00
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 45 694 9.0E-79
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 45 700 9.0E-77
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 45 749 8.0E-60
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 45 749 5.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 31 749 0.0E+00
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 45 694 9.0E-79
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 45 700 9.0E-77
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 45 749 8.0E-60
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 45 749 5.0E-59
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 48 749 2.0E-54
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 48 749 1.0E-50
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 35 749 3.0E-49
sp|P50904|RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus GN=Rasa1 PE=3 SV=1 127 442 1.0E-20
sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 127 442 5.0E-19
sp|P09851|RASA1_BOVIN Ras GTPase-activating protein 1 OS=Bos taurus GN=RASA1 PE=1 SV=1 127 442 6.0E-19
sp|Q55AR6|NFAA_DICDI Neurofibromin-A OS=Dictyostelium discoideum GN=nfaA PE=3 SV=1 108 407 2.0E-18
sp|Q9UJF2|NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens GN=RASAL2 PE=1 SV=2 327 470 3.0E-17
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 44 472 2.0E-16
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 130 410 4.0E-15
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 178 426 9.0E-14
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 178 410 1.0E-13
sp|Q5VWQ8|DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens GN=DAB2IP PE=1 SV=2 184 470 3.0E-13
sp|Q6P730|DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus GN=Dab2ip PE=1 SV=1 184 470 3.0E-13
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 178 410 4.0E-13
sp|Q3UHC7|DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus GN=Dab2ip PE=1 SV=1 184 470 5.0E-13
sp|O95294|RASL1_HUMAN RasGAP-activating-like protein 1 OS=Homo sapiens GN=RASAL1 PE=1 SV=3 178 408 6.0E-13
sp|Q9Z268|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=1 SV=2 178 414 1.0E-12
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 130 410 1.0E-12
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 130 410 2.0E-12
sp|A2RV61|GAPD1_XENLA GTPase-activating protein and VPS9 domain-containing protein 1 OS=Xenopus laevis GN=gapvd1 PE=2 SV=1 113 373 5.0E-12
sp|P19158|IRA2_YEAST Inhibitory regulator protein IRA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA2 PE=1 SV=2 275 406 1.0E-11
sp|Q54Y08|NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum GN=ngap PE=2 SV=1 288 408 2.0E-11
sp|Q9QUH6|SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus GN=Syngap1 PE=1 SV=2 184 437 2.0E-10
sp|Q5A506|BUD2_CANAL GTPase activating protein BUD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD2 PE=2 SV=1 318 447 2.0E-10
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 45 746 2.0E-10
sp|F6SEU4|SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus GN=Syngap1 PE=1 SV=2 184 437 2.0E-10
sp|Q96PV0|SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens GN=SYNGAP1 PE=1 SV=4 184 437 2.0E-10
sp|Q8MLZ5|GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans GN=gap-2 PE=2 SV=2 184 403 3.0E-10
sp|Q14C86|GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens GN=GAPVD1 PE=1 SV=2 113 382 1.0E-09
sp|A5D794|GAPD1_BOVIN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Bos taurus GN=GAPVD1 PE=2 SV=1 113 382 2.0E-09
sp|Q8T498|GAP2_DROME Probable Ras GTPase-activating protein OS=Drosophila melanogaster GN=CG42684 PE=1 SV=3 185 402 8.0E-09
sp|P33314|BUD2_YEAST Inhibitory regulator protein BUD2/CLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD2 PE=1 SV=2 181 393 2.0E-08
sp|P18963|IRA1_YEAST Inhibitory regulator protein IRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA1 PE=1 SV=2 151 408 4.0E-08
sp|Q86YV0|RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens GN=RASAL3 PE=1 SV=2 327 402 7.0E-08
sp|Q8C2K5|RASL3_MOUSE RAS protein activator like-3 OS=Mus musculus GN=Rasal3 PE=1 SV=1 327 402 8.0E-08
sp|A6QQ91|RASL3_BOVIN RAS protein activator like-3 OS=Bos taurus GN=RASAL3 PE=2 SV=1 327 402 2.0E-07
sp|P58069|RASA2_MOUSE Ras GTPase-activating protein 2 OS=Mus musculus GN=Rasa2 PE=1 SV=2 110 395 3.0E-07
sp|Q29HW3|RME6_DROPS Receptor-mediated endocytosis protein 6 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA14078 PE=3 SV=2 133 373 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043087 regulation of GTPase activity Yes
GO:0005515 protein binding Yes
GO:0065009 regulation of molecular function No
GO:0003674 molecular_function No
GO:0051336 regulation of hydrolase activity No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050790 regulation of catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3047
MSSYDGTRSARQSKRYSMSALYMSMSANEGEMQIEDDLAKAQKILRELKSKISSQSKKNFVLEKDVRYLDSRIAL
LIQNRMALEEQNEVASRLEDAADMQEGFFPNDDKTQKYGNLLFLLQSEPRHIAHLCRLVSMAEIDSLLQTVMFTI
YGNQYESREEHLLLTMFQSVLTYQFDDTPDYSSLLRANTPVSRMMTTYTRRGPGQSFLKTVLADKINGLIELKDL
DLEINPLKVYERLVEQEEAKLGSAPPHLPKGITAEQAAENAEVIAIIRPRLAMLTEIANGFLTTIIDGLEEAPYG
IRWICKQIRSLTKRKYPDANDTVICTLIGGFFFLRFINPAIVTPKSYMLIDGTPSERPRRTLTLIAKMLQNLANK
PSYSKEPYMAKLQPFIQQNRERINRFMLDLCEVSDFYESLEMDNYVALSKKDLELDITLNEIYAMHSLIDKHHTE
MCKGENSHLAIIMSELGPAPSQVPRKENRVINLPLFSRWETAIDDLTAALDITQEEVYFMEAKSIFVQIMRSIPQ
NNAVLRRPLRLERVADAAATSRNDAVMVRKGIRAMELLSQLQELGVIDKSDQFGLLRDEVEQELQHLGSLKDGVI
AETQKLDEVYKTIRDHNTYLVGQLETYKSYLHNVRSQSEGTKRKQQKQQVLGPYKFTHQQLEKEGVIQKSNVPDN
RRANIFFNFISPLPGTFVISLHYKGRSRGLLELDLKLDDLLEMQKDNQEELDLEYVQFNVPKVLALLNKRFARKK
GW*
Coding >OphauG2|3047
ATGTCTTCCTACGATGGCACGCGCTCTGCGCGTCAGTCTAAACGCTACTCCATGTCTGCCCTCTACATGTCCATG
TCGGCCAACGAGGGCGAGATGCAAATAGAGGACGATCTTGCAAAAGCCCAAAAGATACTCCGCGAGCTCAAATCC
AAGATTTCATCTCAGTCAAAGAAGAATTTTGTCCTTGAGAAAGACGTTCGCTATCTCGATTCCCGAATTGCCCTT
CTAATCCAGAATCGCATGGCTCTTGAAGAGCAAAACGAAGTCGCTAGTCGTCTTGAGGATGCGGCCGACATGCAG
GAAGGCTTTTTCCCCAATGACGACAAGACACAAAAATACGGCAACCTGCTGTTCCTTCTTCAGTCCGAGCCGCGC
CACATTGCCCATCTCTGTCGGCTTGTTTCCATGGCAGAAATAGACTCTTTGTTGCAAACAGTCATGTTCACCATC
TACGGAAATCAATACGAGAGCCGCGAGGAGCATTTGCTTCTCACCATGTTTCAATCTGTCTTGACATACCAATTC
GACGATACACCCGACTATTCTTCTCTTCTGCGCGCAAATACGCCTGTATCGCGCATGATGACTACCTATACCCGA
CGCGGTCCAGGCCAAAGCTTTCTCAAGACGGTGCTGGCTGATAAGATCAACGGCCTTATCGAGCTCAAAGATCTG
GACCTCGAAATCAACCCCCTCAAAGTATATGAACGTTTGGTGGAGCAGGAAGAGGCCAAGCTCGGCAGCGCACCG
CCACATCTACCCAAAGGAATTACGGCTGAGCAGGCCGCCGAGAACGCCGAGGTCATCGCAATTATACGGCCCCGA
CTGGCAATGCTGACTGAAATTGCCAATGGCTTTCTCACTACAATCATCGACGGCCTGGAAGAGGCCCCCTATGGT
ATCCGCTGGATCTGCAAGCAGATTCGCAGTCTGACGAAGCGCAAGTATCCTGACGCCAACGACACTGTCATCTGC
ACCCTTATTGGCGGCTTTTTCTTCTTGCGCTTCATTAACCCTGCCATTGTGACACCAAAGTCATACATGCTTATT
GACGGCACACCGTCGGAGCGGCCGCGCCGGACCCTGACCTTGATTGCCAAGATGCTTCAAAACTTGGCCAACAAG
CCGTCCTACTCCAAGGAGCCATACATGGCCAAGCTTCAGCCCTTTATCCAGCAAAACAGGGAACGGATCAATAGA
TTCATGCTCGACCTTTGTGAAGTGAGCGATTTTTACGAAAGCCTAGAAATGGACAACTACGTCGCCCTCTCCAAG
AAGGACCTGGAGCTGGACATTACGCTCAACGAAATCTATGCCATGCACTCTCTCATCGACAAGCACCATACGGAA
ATGTGCAAAGGCGAAAACTCTCACCTGGCCATCATCATGTCCGAGCTCGGCCCTGCGCCCTCACAGGTGCCACGC
AAGGAAAACAGGGTCATCAACCTGCCTCTATTTAGCAGGTGGGAGACGGCCATTGATGACCTCACGGCCGCGCTT
GACATCACGCAGGAGGAAGTGTACTTTATGGAAGCCAAGTCCATCTTCGTGCAGATTATGCGCTCCATTCCCCAA
AACAATGCGGTTCTTCGGCGGCCCCTTCGACTCGAGCGCGTCGCTGATGCAGCGGCAACCAGCCGCAATGACGCC
GTCATGGTGCGCAAGGGTATTCGAGCCATGGAGCTCCTATCACAGCTGCAGGAGCTTGGCGTCATTGACAAGAGC
GATCAATTTGGGCTCCTGCGCGATGAGGTGGAACAGGAGCTACAACATCTTGGCTCCCTCAAGGATGGCGTTATC
GCTGAGACGCAGAAGCTTGATGAGGTCTACAAGACGATTCGCGACCATAACACGTATCTCGTTGGCCAGCTTGAG
ACATACAAGAGCTACCTGCACAATGTGCGATCGCAGAGCGAAGGAACTAAGCGCAAGCAACAGAAGCAGCAGGTG
CTTGGACCGTACAAGTTTACGCACCAGCAGCTCGAAAAGGAGGGAGTGATTCAGAAGAGCAATGTTCCGGATAAC
AGGCGGGCCAACATCTTCTTCAATTTTATCAGCCCTCTGCCCGGGACCTTTGTCATTTCACTGCATTACAAGGGT
CGAAGCCGCGGCCTCCTGGAGCTCGACCTGAAGCTTGACGACTTGCTTGAAATGCAAAAAGATAACCAGGAGGAG
CTAGATCTCGAGTACGTCCAGTTCAATGTGCCCAAGGTCTTGGCCCTTTTGAACAAACGTTTTGCCCGCAAGAAG
GGATGGTGA
Transcript >OphauG2|3047
ATGTCTTCCTACGATGGCACGCGCTCTGCGCGTCAGTCTAAACGCTACTCCATGTCTGCCCTCTACATGTCCATG
TCGGCCAACGAGGGCGAGATGCAAATAGAGGACGATCTTGCAAAAGCCCAAAAGATACTCCGCGAGCTCAAATCC
AAGATTTCATCTCAGTCAAAGAAGAATTTTGTCCTTGAGAAAGACGTTCGCTATCTCGATTCCCGAATTGCCCTT
CTAATCCAGAATCGCATGGCTCTTGAAGAGCAAAACGAAGTCGCTAGTCGTCTTGAGGATGCGGCCGACATGCAG
GAAGGCTTTTTCCCCAATGACGACAAGACACAAAAATACGGCAACCTGCTGTTCCTTCTTCAGTCCGAGCCGCGC
CACATTGCCCATCTCTGTCGGCTTGTTTCCATGGCAGAAATAGACTCTTTGTTGCAAACAGTCATGTTCACCATC
TACGGAAATCAATACGAGAGCCGCGAGGAGCATTTGCTTCTCACCATGTTTCAATCTGTCTTGACATACCAATTC
GACGATACACCCGACTATTCTTCTCTTCTGCGCGCAAATACGCCTGTATCGCGCATGATGACTACCTATACCCGA
CGCGGTCCAGGCCAAAGCTTTCTCAAGACGGTGCTGGCTGATAAGATCAACGGCCTTATCGAGCTCAAAGATCTG
GACCTCGAAATCAACCCCCTCAAAGTATATGAACGTTTGGTGGAGCAGGAAGAGGCCAAGCTCGGCAGCGCACCG
CCACATCTACCCAAAGGAATTACGGCTGAGCAGGCCGCCGAGAACGCCGAGGTCATCGCAATTATACGGCCCCGA
CTGGCAATGCTGACTGAAATTGCCAATGGCTTTCTCACTACAATCATCGACGGCCTGGAAGAGGCCCCCTATGGT
ATCCGCTGGATCTGCAAGCAGATTCGCAGTCTGACGAAGCGCAAGTATCCTGACGCCAACGACACTGTCATCTGC
ACCCTTATTGGCGGCTTTTTCTTCTTGCGCTTCATTAACCCTGCCATTGTGACACCAAAGTCATACATGCTTATT
GACGGCACACCGTCGGAGCGGCCGCGCCGGACCCTGACCTTGATTGCCAAGATGCTTCAAAACTTGGCCAACAAG
CCGTCCTACTCCAAGGAGCCATACATGGCCAAGCTTCAGCCCTTTATCCAGCAAAACAGGGAACGGATCAATAGA
TTCATGCTCGACCTTTGTGAAGTGAGCGATTTTTACGAAAGCCTAGAAATGGACAACTACGTCGCCCTCTCCAAG
AAGGACCTGGAGCTGGACATTACGCTCAACGAAATCTATGCCATGCACTCTCTCATCGACAAGCACCATACGGAA
ATGTGCAAAGGCGAAAACTCTCACCTGGCCATCATCATGTCCGAGCTCGGCCCTGCGCCCTCACAGGTGCCACGC
AAGGAAAACAGGGTCATCAACCTGCCTCTATTTAGCAGGTGGGAGACGGCCATTGATGACCTCACGGCCGCGCTT
GACATCACGCAGGAGGAAGTGTACTTTATGGAAGCCAAGTCCATCTTCGTGCAGATTATGCGCTCCATTCCCCAA
AACAATGCGGTTCTTCGGCGGCCCCTTCGACTCGAGCGCGTCGCTGATGCAGCGGCAACCAGCCGCAATGACGCC
GTCATGGTGCGCAAGGGTATTCGAGCCATGGAGCTCCTATCACAGCTGCAGGAGCTTGGCGTCATTGACAAGAGC
GATCAATTTGGGCTCCTGCGCGATGAGGTGGAACAGGAGCTACAACATCTTGGCTCCCTCAAGGATGGCGTTATC
GCTGAGACGCAGAAGCTTGATGAGGTCTACAAGACGATTCGCGACCATAACACGTATCTCGTTGGCCAGCTTGAG
ACATACAAGAGCTACCTGCACAATGTGCGATCGCAGAGCGAAGGAACTAAGCGCAAGCAACAGAAGCAGCAGGTG
CTTGGACCGTACAAGTTTACGCACCAGCAGCTCGAAAAGGAGGGAGTGATTCAGAAGAGCAATGTTCCGGATAAC
AGGCGGGCCAACATCTTCTTCAATTTTATCAGCCCTCTGCCCGGGACCTTTGTCATTTCACTGCATTACAAGGGT
CGAAGCCGCGGCCTCCTGGAGCTCGACCTGAAGCTTGACGACTTGCTTGAAATGCAAAAAGATAACCAGGAGGAG
CTAGATCTCGAGTACGTCCAGTTCAATGTGCCCAAGGTCTTGGCCCTTTTGAACAAACGTTTTGCCCGCAAGAAG
GGATGGTGA
Gene >OphauG2|3047
ATGTCTTCCTACGATGGCACGCGCTCTGCGCGTCAGTCTAAACGCTACTCCATGTCTGCCCTCTACATGTCCATG
TCGGCCAACGAGGGCGAGATGCAAATAGAGGACGATCTTGCAAAAGGTAAATGGCCCTTTTGCACTCTGTCCACG
CACTTGTGCTGACTGCTCTCTTTTTTTTTCCCCTTTGCAGCCCAAAAGATACTCCGCGAGCTCAAATCCAAGATT
TCATCTCAGTCAAAGAAGAATTTTGTCCTTGAGAAAGACGTTCGCTATCTCGATTCCCGAATTGCCCTTCTAATC
CAGAATCGCATGGCTCTTGAAGAGGTTTGTACCCGCGCGAATTTCCTTTTTTACCCGACATGATCACTGATGTAA
GCTATCTAGCAAAACGAAGTCGCTAGTCGTCTTGAGGATGCGGCCGACATGCAGGAAGGCTTTTTCCCCAATGAC
GACAAGACACAAAAATACGGCAACCTGCTGTTCCTTCTTCAGTCCGAGCCGCGCCACATTGCCCATCTCTGTCGG
CTTGTTTCCATGGCAGAAATAGACTCTTTGTTGCAAACAGTCATGTTCACCATCTACGGAAATCAATACGAGAGC
CGCGAGGAGCATTTGCTTCTCACCATGTTTCAAGTAGGCATAAATATCACGCCTCATCTCTCGTGCATGTTTCTT
TGAACAGGAGCTGACTTGACCTTTTCAGTCTGTCTTGACATACCAATTCGACGATACACCCGACTATTCTTCTCT
TCTGCGCGCAAATACGCCTGTATCGCGCATGATGACTACCTATACCCGACGCGGTCCAGGCCAAAGCTTTCTCAA
GACGGTGCTGGCTGATAAGATCAACGGCCTTATCGAGCTCAAAGATCTGGACCTCGAAATCAACCCCCTCAAAGT
ATATGAACGTTTGGTGGAGCAGGAAGAGGCCAAGCTCGGCAGCGCACCGCCACATCTACCCAAAGGAATTACGGC
TGAGCAGGCCGCCGAGAACGCCGAGGTCATCGCAATTATACGGCCCCGACTGGCAATGCTGACTGAAATTGCCAA
TGGCTTTCTCACTACAATCATCGACGGCCTGGAAGAGGCCCCCTATGGTATCCGCTGGATCTGCAAGCAGATTCG
CAGTCTGACGAAGCGCAAGTATCCTGACGCCAACGACACTGTCATCTGCACCCTTATTGGCGGCTTTTTCTTCTT
GCGCTTCATTAACCCTGCCATTGTGACACCAAAGTCATACATGCTTATTGACGGCACACCGTCGGAGCGGCCGCG
CCGGACCCTGACCTTGATTGCCAAGATGCTTCAAAACTTGGCCAACAAGCCGTCCTACTCCAAGGAGCCATACAT
GGCCAAGCTTCAGCCCTTTATCCAGCAAAACAGGGAACGGATCAATAGATTCATGCTCGACCTTTGTGAAGTGAG
CGATTTTTACGAAAGCCTAGAAATGGACAACTACGTCGCCCTCTCCAAGAAGGACCTGGAGCTGGACATTACGCT
CAACGAAATCTATGCCATGCACTCTCTCATCGACAAGCACCATACGGAAATGTGCAAAGGCGAAAACTCTCACCT
GGCCATCATCATGTCCGAGCTCGGCCCTGCGCCCTCACAGGTGCCACGCAAGGAAAACAGGGTCATCAACCTGCC
TCTATTTAGCAGGTGGGAGACGGCCATTGATGACCTCACGGCCGCGCTTGACATCACGCAGGAGGAAGTGTACTT
TATGGAAGCCAAGTCCATCTTCGTGCAGATTATGCGCTCCATTCCCCAAAACAATGCGGTTCTTCGGCGGCCCCT
TCGACTCGAGCGCGTCGCTGATGCAGCGGCAACCAGCCGCAATGACGCCGTCATGGTGCGCAAGGGTATTCGAGC
CATGGAGCTCCTATCACAGCTGCAGGAGCTTGGCGTCATTGACAAGAGCGATCAATTTGGGCTCCTGCGCGATGA
GGTGGAACAGGAGCTACAACATCTTGGCTCCCTCAAGGATGGCGTTATCGCTGAGACGCAGAAGCTTGATGAGGT
CTACAAGACGATTCGCGACCATAACACGTATCTCGTTGGCCAGCTTGAGACATACAAGAGCTACCTGCACAATGT
GCGATCGCAGAGCGAAGGAACTAAGCGCAAGCAACAGAAGCAGCAGGTGCTTGGACCGTACAAGTTTACGCACCA
GCAGCTCGAAAAGGAGGGAGTGATTCAGAAGAGCAATGTTCCGGATAACAGGCGGGCCAACATCTTCTTCAATTT
TATCAGCCCTCTGCCCGGGACCTTTGTCATTTCACTGCATTACAAGGGTAATGCCCACTTGTTTTTCAAAATGTT
GATTGCGCCGGTGGTGTGTACTGACGCTGTAGCAGGTCGAAGCCGCGGCCTCCTGGAGCTCGACCTGAAGCTTGA
CGACTTGCTTGAAATGCAAAAAGATAACCAGGAGGAGCTAGATCTCGAGTACGTCCAGTTCAATGTGCCCAAGGT
CTTGGCCCTTTTGAACAAACGTTTTGCCCGCAAGAAGGGATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail