Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3043
Gene name
LocationContig_223:1434..4553
Strand-
Gene length (bp)3119
Transcript length (bp)2979
Coding sequence length (bp)2979
Protein length (aa) 993

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08596 Lgl_C Lethal giant larvae(Lgl) like, C-terminal 4.7E-118 509 902

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38163|SRO77_YEAST Lethal(2) giant larvae protein homolog SRO77 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO77 PE=1 SV=2 14 924 7.0E-127
sp|Q12038|SRO7_YEAST Lethal(2) giant larvae protein homolog SRO7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO7 PE=1 SV=1 16 902 5.0E-124
sp|Q10408|YD83_SCHPO Uncharacterized protein C1F3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F3.03 PE=4 SV=1 28 989 5.0E-79
sp|Q9Y2K9|STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens GN=STXBP5L PE=1 SV=2 12 261 3.0E-11
sp|Q5DQR4|STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus GN=Stxbp5l PE=1 SV=1 13 261 8.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38163|SRO77_YEAST Lethal(2) giant larvae protein homolog SRO77 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO77 PE=1 SV=2 14 924 7.0E-127
sp|Q12038|SRO7_YEAST Lethal(2) giant larvae protein homolog SRO7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO7 PE=1 SV=1 16 902 5.0E-124
sp|Q10408|YD83_SCHPO Uncharacterized protein C1F3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F3.03 PE=4 SV=1 28 989 5.0E-79
sp|Q9Y2K9|STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens GN=STXBP5L PE=1 SV=2 12 261 3.0E-11
sp|Q5DQR4|STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus GN=Stxbp5l PE=1 SV=1 13 261 8.0E-11
sp|Q9WU70|STXB5_RAT Syntaxin-binding protein 5 OS=Rattus norvegicus GN=Stxbp5 PE=1 SV=1 15 483 5.0E-10
sp|Q5T5C0|STXB5_HUMAN Syntaxin-binding protein 5 OS=Homo sapiens GN=STXBP5 PE=1 SV=1 15 483 6.0E-10
sp|Q8K400|STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus GN=Stxbp5 PE=1 SV=3 15 483 6.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5207
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3043 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2046
Ophiocordyceps camponoti-floridani Ophcf2|05275
Ophiocordyceps camponoti-rufipedis Ophun1|1187
Ophiocordyceps kimflemingae Ophio5|7163
Ophiocordyceps subramaniannii Hirsu2|4132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3043
MAGFLRSKQAGIQNDLSASIRAELFTPDDQARYGINSQISCLGYDAVQSLLAIGTSESKFGGGKIYVLGQGRVQK
VLEAGRATSFQQLHFSGNRLISLDSKNQVGIWDVDSGLRLAAQVMAGHVVAMATDPMLDWAFVGLQNGEVVAYDL
DRQCLARSFRLANMWRERGASGLAATLVCLAMHPRDAGKLLIGYTHGAVIYSFKQNCAVSFFEYVLPPGAPGGSS
VGVDTQRRPRLTHALWHPSGTFVVTAHEDGSLAFWDPREDRLVTARTLEQTHIEQPAPNAAVPTRTEPFTSLAWC
CKQNCDDTGLLVSGGQSMDVSPKSMTFIELGLTPTYATSSWHALADYFAGNRHLSLPLPSGAQAVDFILVPRASP
HFAGAQDPVAIMSLLSSGELFTMSFPSGYPISPTNQLHPSTFFVHPFITKMNVSTLERPRWLSMMEKRNQGEPLL
KGGAEGPRPRKRFEARTIIQAAQADSTIRIWDSGHADDIENSQVLQVDLARALDRYQDIEVTAMSMASGTGEFVV
GTRTGEAVVFRWGSNRHYGKEAPAQQLDPNPKGLTDIGVRAEPALIEGLQPFVLYEMVQGPITAVAASSVGFVAI
GSELGFMSVMDLRGPRIIFQAPMTDFVKHEKRSSFLRGHHRSTSNSAGAPKEWPVVIEFGVMTLDEDKYSSICCF
VGTNLGKIITMKLLPAADGSYSVQVAGVVQLDGKMISISPIEADTGRPALATGPVVAGLREGRQVHGVVVAVTQT
EIRIFKPAHSKGASREFDDVLCDAASVVELELQGYAIVGLFGDGTARAFSIPGLKDVGKAELGMVDGSRSTSAVV
TATGDIFAWTGPSELAVVHVWGTGKPLQQSPDVLINPKLECPPRPTISGLQWISGTQYVSPTDLDLLVGGPDRPP
SKRMLEAAAAEQRAARSRQAGASLGGTAAGGQEGWGEYLTRQLNERTEKLNIMGDGMENLQQQSQGWADDVNKFM
GRQKRNIVLGGLKSKFF*
Coding >OphauG2|3043
ATGGCGGGCTTCCTACGCAGCAAACAGGCAGGTATACAAAATGACCTGTCGGCCAGCATCAGGGCAGAGTTGTTT
ACGCCCGACGACCAGGCACGATACGGGATCAACTCCCAGATCAGTTGCCTGGGGTACGATGCAGTGCAGTCGCTG
CTTGCCATTGGAACATCGGAGAGCAAGTTTGGCGGCGGCAAGATTTACGTGTTGGGCCAGGGCCGGGTGCAAAAG
GTTCTCGAGGCTGGACGAGCAACGTCATTCCAGCAGCTACACTTCAGCGGCAACCGGCTCATCAGCCTGGACAGC
AAGAACCAAGTGGGAATATGGGACGTGGACTCGGGGCTGCGACTGGCGGCGCAGGTGATGGCGGGACACGTGGTG
GCCATGGCTACGGACCCGATGCTGGACTGGGCGTTTGTCGGACTGCAAAACGGCGAGGTGGTGGCGTACGACTTG
GACAGACAGTGCCTGGCACGGAGCTTTCGGCTGGCCAACATGTGGAGGGAGCGCGGGGCGAGTGGGCTGGCGGCG
ACTCTGGTGTGCCTGGCGATGCATCCGCGCGACGCGGGCAAGTTGCTTATTGGGTACACGCACGGGGCCGTCATC
TACTCGTTCAAGCAAAACTGCGCCGTGAGCTTCTTTGAGTACGTGTTGCCGCCAGGGGCGCCGGGGGGAAGCAGC
GTGGGCGTGGACACGCAGCGGCGGCCTCGGCTGACGCATGCCCTGTGGCACCCGTCGGGGACGTTTGTCGTGACG
GCGCATGAGGATGGCAGCCTGGCGTTTTGGGATCCGCGAGAGGACAGGCTGGTTACGGCGCGGACGCTGGAGCAG
ACGCACATCGAGCAGCCGGCGCCCAACGCGGCGGTGCCGACACGGACGGAGCCATTCACGTCGCTTGCGTGGTGC
TGCAAGCAAAACTGCGACGACACGGGTCTACTAGTGTCTGGGGGCCAGTCGATGGATGTGTCGCCCAAGAGCATG
ACGTTTATTGAGCTGGGCTTGACGCCGACGTACGCAACGTCGTCGTGGCATGCACTGGCCGACTACTTTGCGGGC
AACAGGCACTTGTCGCTGCCGCTGCCATCGGGCGCGCAAGCCGTCGACTTTATCCTGGTTCCACGGGCCTCGCCG
CACTTTGCCGGGGCCCAAGACCCCGTGGCCATCATGTCGCTCTTGTCATCGGGCGAGCTCTTCACCATGAGCTTT
CCCTCGGGCTACCCCATCAGCCCGACCAACCAACTGCATCCCTCGACCTTTTTCGTGCATCCCTTCATCACCAAG
ATGAATGTGTCGACACTGGAGCGGCCCAGGTGGCTCAGCATGATGGAGAAGCGGAACCAGGGCGAGCCGCTGCTC
AAGGGGGGAGCCGAAGGGCCGCGACCTCGCAAGAGGTTTGAGGCAAGGACAATTATCCAGGCAGCGCAGGCCGAC
AGCACGATACGCATCTGGGACTCGGGCCATGCCGACGACATTGAAAACAGCCAGGTGCTGCAGGTGGACCTGGCG
CGCGCGCTGGACAGGTACCAGGACATTGAAGTGACGGCCATGAGCATGGCCAGCGGCACGGGCGAGTTTGTTGTT
GGCACACGGACGGGCGAGGCAGTCGTCTTTCGCTGGGGCAGCAACAGGCACTACGGGAAAGAGGCGCCGGCGCAG
CAACTGGACCCCAATCCAAAGGGCTTGACGGACATTGGGGTACGCGCGGAGCCAGCCCTCATAGAAGGTCTGCAG
CCGTTTGTACTCTACGAGATGGTGCAGGGACCGATTACAGCGGTAGCGGCCTCAAGCGTCGGGTTTGTTGCAATT
GGATCAGAGCTGGGCTTCATGTCTGTCATGGATCTGCGAGGGCCGCGCATCATTTTCCAGGCGCCCATGACGGAC
TTTGTCAAGCACGAGAAGCGGTCTTCGTTTCTCAGAGGCCACCACCGCTCGACTTCCAACTCGGCGGGGGCGCCC
AAGGAGTGGCCAGTGGTTATCGAGTTTGGCGTCATGACGCTTGACGAGGACAAGTACTCGAGCATCTGCTGTTTT
GTGGGCACCAACCTGGGTAAGATTATTACCATGAAGCTTCTGCCGGCTGCAGATGGATCCTACTCGGTACAGGTT
GCTGGGGTAGTGCAGTTGGACGGCAAAATGATTTCGATATCGCCCATTGAGGCGGACACGGGAAGGCCGGCGTTG
GCGACGGGCCCCGTGGTTGCCGGACTGCGCGAGGGTCGTCAAGTGCATGGGGTTGTTGTTGCAGTCACACAGACG
GAGATTCGCATCTTTAAGCCAGCACACTCCAAGGGAGCGTCGAGGGAATTCGACGACGTCTTGTGCGATGCAGCA
AGCGTGGTAGAGCTGGAACTTCAAGGCTACGCCATTGTGGGATTGTTTGGGGACGGGACGGCACGGGCGTTTTCG
ATTCCCGGGCTCAAGGATGTTGGCAAGGCGGAGCTGGGCATGGTGGACGGCAGTCGCAGCACGTCGGCGGTTGTG
ACGGCGACGGGCGACATCTTTGCATGGACGGGGCCAAGCGAACTGGCCGTGGTGCACGTATGGGGCACGGGCAAG
CCGCTGCAACAGTCGCCCGACGTGCTCATCAACCCCAAGCTCGAGTGTCCGCCGCGGCCTACGATTTCGGGGCTG
CAGTGGATCTCGGGGACGCAGTACGTGTCGCCGACGGACCTGGACCTGCTGGTGGGCGGGCCCGACCGTCCGCCG
AGCAAGCGGATGCTGGAAGCGGCGGCGGCAGAGCAGCGGGCGGCGCGGAGTAGGCAAGCCGGGGCGAGTTTGGGA
GGGACAGCAGCGGGGGGTCAGGAGGGCTGGGGAGAGTATCTGACGAGGCAACTGAATGAACGGACGGAGAAGCTC
AACATAATGGGAGATGGCATGGAGAATCTGCAGCAGCAGAGCCAGGGATGGGCGGACGATGTGAATAAGTTTATG
GGACGGCAGAAGCGCAACATTGTGCTTGGGGGGCTCAAGAGCAAGTTTTTCTAG
Transcript >OphauG2|3043
ATGGCGGGCTTCCTACGCAGCAAACAGGCAGGTATACAAAATGACCTGTCGGCCAGCATCAGGGCAGAGTTGTTT
ACGCCCGACGACCAGGCACGATACGGGATCAACTCCCAGATCAGTTGCCTGGGGTACGATGCAGTGCAGTCGCTG
CTTGCCATTGGAACATCGGAGAGCAAGTTTGGCGGCGGCAAGATTTACGTGTTGGGCCAGGGCCGGGTGCAAAAG
GTTCTCGAGGCTGGACGAGCAACGTCATTCCAGCAGCTACACTTCAGCGGCAACCGGCTCATCAGCCTGGACAGC
AAGAACCAAGTGGGAATATGGGACGTGGACTCGGGGCTGCGACTGGCGGCGCAGGTGATGGCGGGACACGTGGTG
GCCATGGCTACGGACCCGATGCTGGACTGGGCGTTTGTCGGACTGCAAAACGGCGAGGTGGTGGCGTACGACTTG
GACAGACAGTGCCTGGCACGGAGCTTTCGGCTGGCCAACATGTGGAGGGAGCGCGGGGCGAGTGGGCTGGCGGCG
ACTCTGGTGTGCCTGGCGATGCATCCGCGCGACGCGGGCAAGTTGCTTATTGGGTACACGCACGGGGCCGTCATC
TACTCGTTCAAGCAAAACTGCGCCGTGAGCTTCTTTGAGTACGTGTTGCCGCCAGGGGCGCCGGGGGGAAGCAGC
GTGGGCGTGGACACGCAGCGGCGGCCTCGGCTGACGCATGCCCTGTGGCACCCGTCGGGGACGTTTGTCGTGACG
GCGCATGAGGATGGCAGCCTGGCGTTTTGGGATCCGCGAGAGGACAGGCTGGTTACGGCGCGGACGCTGGAGCAG
ACGCACATCGAGCAGCCGGCGCCCAACGCGGCGGTGCCGACACGGACGGAGCCATTCACGTCGCTTGCGTGGTGC
TGCAAGCAAAACTGCGACGACACGGGTCTACTAGTGTCTGGGGGCCAGTCGATGGATGTGTCGCCCAAGAGCATG
ACGTTTATTGAGCTGGGCTTGACGCCGACGTACGCAACGTCGTCGTGGCATGCACTGGCCGACTACTTTGCGGGC
AACAGGCACTTGTCGCTGCCGCTGCCATCGGGCGCGCAAGCCGTCGACTTTATCCTGGTTCCACGGGCCTCGCCG
CACTTTGCCGGGGCCCAAGACCCCGTGGCCATCATGTCGCTCTTGTCATCGGGCGAGCTCTTCACCATGAGCTTT
CCCTCGGGCTACCCCATCAGCCCGACCAACCAACTGCATCCCTCGACCTTTTTCGTGCATCCCTTCATCACCAAG
ATGAATGTGTCGACACTGGAGCGGCCCAGGTGGCTCAGCATGATGGAGAAGCGGAACCAGGGCGAGCCGCTGCTC
AAGGGGGGAGCCGAAGGGCCGCGACCTCGCAAGAGGTTTGAGGCAAGGACAATTATCCAGGCAGCGCAGGCCGAC
AGCACGATACGCATCTGGGACTCGGGCCATGCCGACGACATTGAAAACAGCCAGGTGCTGCAGGTGGACCTGGCG
CGCGCGCTGGACAGGTACCAGGACATTGAAGTGACGGCCATGAGCATGGCCAGCGGCACGGGCGAGTTTGTTGTT
GGCACACGGACGGGCGAGGCAGTCGTCTTTCGCTGGGGCAGCAACAGGCACTACGGGAAAGAGGCGCCGGCGCAG
CAACTGGACCCCAATCCAAAGGGCTTGACGGACATTGGGGTACGCGCGGAGCCAGCCCTCATAGAAGGTCTGCAG
CCGTTTGTACTCTACGAGATGGTGCAGGGACCGATTACAGCGGTAGCGGCCTCAAGCGTCGGGTTTGTTGCAATT
GGATCAGAGCTGGGCTTCATGTCTGTCATGGATCTGCGAGGGCCGCGCATCATTTTCCAGGCGCCCATGACGGAC
TTTGTCAAGCACGAGAAGCGGTCTTCGTTTCTCAGAGGCCACCACCGCTCGACTTCCAACTCGGCGGGGGCGCCC
AAGGAGTGGCCAGTGGTTATCGAGTTTGGCGTCATGACGCTTGACGAGGACAAGTACTCGAGCATCTGCTGTTTT
GTGGGCACCAACCTGGGTAAGATTATTACCATGAAGCTTCTGCCGGCTGCAGATGGATCCTACTCGGTACAGGTT
GCTGGGGTAGTGCAGTTGGACGGCAAAATGATTTCGATATCGCCCATTGAGGCGGACACGGGAAGGCCGGCGTTG
GCGACGGGCCCCGTGGTTGCCGGACTGCGCGAGGGTCGTCAAGTGCATGGGGTTGTTGTTGCAGTCACACAGACG
GAGATTCGCATCTTTAAGCCAGCACACTCCAAGGGAGCGTCGAGGGAATTCGACGACGTCTTGTGCGATGCAGCA
AGCGTGGTAGAGCTGGAACTTCAAGGCTACGCCATTGTGGGATTGTTTGGGGACGGGACGGCACGGGCGTTTTCG
ATTCCCGGGCTCAAGGATGTTGGCAAGGCGGAGCTGGGCATGGTGGACGGCAGTCGCAGCACGTCGGCGGTTGTG
ACGGCGACGGGCGACATCTTTGCATGGACGGGGCCAAGCGAACTGGCCGTGGTGCACGTATGGGGCACGGGCAAG
CCGCTGCAACAGTCGCCCGACGTGCTCATCAACCCCAAGCTCGAGTGTCCGCCGCGGCCTACGATTTCGGGGCTG
CAGTGGATCTCGGGGACGCAGTACGTGTCGCCGACGGACCTGGACCTGCTGGTGGGCGGGCCCGACCGTCCGCCG
AGCAAGCGGATGCTGGAAGCGGCGGCGGCAGAGCAGCGGGCGGCGCGGAGTAGGCAAGCCGGGGCGAGTTTGGGA
GGGACAGCAGCGGGGGGTCAGGAGGGCTGGGGAGAGTATCTGACGAGGCAACTGAATGAACGGACGGAGAAGCTC
AACATAATGGGAGATGGCATGGAGAATCTGCAGCAGCAGAGCCAGGGATGGGCGGACGATGTGAATAAGTTTATG
GGACGGCAGAAGCGCAACATTGTGCTTGGGGGGCTCAAGAGCAAGTTTTTCTAG
Gene >OphauG2|3043
ATGGCGGGCTTCCTACGCAGCAAACAGGCAGGTATACAAAATGACCTGTCGGCCAGCATCAGGGCAGAGTTGTTT
ACGCCCGACGACCAGGCACGATACGGGATCAACTCCCAGATCAGGCAAGCCATGACGACAGCAGACAGGCGTAGC
GAGGCGCGAGACTGACGGCAGACTAGTTGCCTGGGGTACGATGCAGTGCAGTCGCTGCTTGCCATTGGAACATCG
GAGAGCAAGTTTGGCGGCGGCAAGATTTACGTGTTGGGCCAGGGCCGGGTGCAAAAGGTTCTCGAGGCTGGACGA
GCAACGTCATTCCAGCAGCTACACTTCAGCGGCAACCGGCTCATCAGCCTGGACAGCAAGAACCAAGTGGGAATA
TGGGACGTGGACTCGGGGCTGCGACTGGCGGCGCAGGTGATGGCGGGACACGTGGTGGCCATGGCTACGGACCCG
ATGCTGGACTGGGCGTTTGTCGGACTGCAAAACGGCGAGGTGGTGGCGTACGACTTGGACAGACAGTGCCTGGCA
CGGAGCTTTCGGCTGGCCAACATGTGGAGGGAGCGCGGGGCGAGTGGGCTGGCGGCGACTCTGGTGTGCCTGGCG
ATGCATCCGCGCGACGCGGGCAAGTTGCTTATTGGGTACACGCACGGGGCCGTCATCTACTCGTTCAAGCAAAAC
TGCGCCGTGAGCTTCTTTGAGTACGTGTTGCCGCCAGGGGCGCCGGGGGGAAGCAGCGTGGGCGTGGACACGCAG
CGGCGGCCTCGGCTGACGCATGCCCTGTGGCACCCGTCGGGGACGTTTGTCGTGACGGCGCATGAGGATGGCAGC
CTGGCGTTTTGGGATCCGCGAGAGGACAGGCTGGTTACGGCGCGGACGCTGGAGCAGACGCACATCGAGCAGCCG
GCGCCCAACGCGGCGGTGCCGACACGGACGGAGCCATTCACGTCGCTTGCGTGGTGCTGCAAGCAAAACTGCGAC
GACACGGGTCTACTAGTGTCTGGGGGCCAGTCGATGGATGTGTCGCCCAAGAGCATGACGTTTATTGAGCTGGGC
TTGACGCCGACGTACGCAACGTCGTCGTGGCATGCACTGGCCGACTACTTTGCGGGCAACAGGCACTTGTCGCTG
CCGCTGCCATCGGGCGCGCAAGCCGTCGACTTTATCCTGGTTCCACGGGCCTCGCCGCACTTTGCCGGGGCCCAA
GACCCCGTGGCCATCATGTCGCTCTTGTCATCGGGCGAGCTCTTCACCATGAGCTTTCCCTCGGGCTACCCCATC
AGCCCGACCAACCAACTGCATCCCTCGACCTTTTTCGTGCATCCCTTCATCACCAAGATGAATGTGTCGACACTG
GAGCGGCCCAGGTGGCTCAGCATGATGGAGAAGCGGAACCAGGGCGAGCCGCTGCTCAAGGGGGGAGCCGAAGGG
CCGCGACCTCGCAAGAGGTTTGAGGCAAGGACAATTATCCAGGCAGCGCAGGCCGACAGCACGATACGCATCTGG
GACTCGGGCCATGCCGACGACATTGAAAACAGCCAGGTGCTGCAGGTGGACCTGGCGCGCGCGCTGGACAGGTAC
CAGGACATTGAAGTGACGGCCATGAGCATGGCCAGCGGCACGGGCGAGTTTGTTGTTGGCACACGGACGGGCGAG
GCAGTCGTCTTTCGCTGGGGCAGCAACAGGCACTACGGGAAAGAGGCGCCGGCGCAGCAACTGGACCCCAATCCA
AAGGGCTTGACGGACATTGGGGTACGCGCGGAGCCAGCCCTCATAGAAGGTCTGCAGCCGTTTGTACTCTACGAG
ATGGTGCAGGGACCGATTACAGCGGTAGCGGCCTCAAGCGTCGGGTTTGTTGCAATTGGATCAGAGCTGGGCTTC
ATGTCTGTCATGGATCTGCGAGGGCCGCGCATCATTTTCCAGGCGCCCATGACGGACTTTGTCAAGCACGAGAAG
CGGTCTTCGTTTCTCAGAGGCCACCACCGCTCGACTTCCAACTCGGCGGGGGCGCCCAAGGAGTGGCCAGTGGTT
ATCGAGTTTGGCGTCATGACGCTTGACGAGGACAAGTACTCGAGCATCTGCTGTTTTGTGGGCACCAACCTGGGT
AAGATTATTACCATGAAGCTTCTGCCGGCTGCAGATGGATCCTACTCGGTACAGGTTGCTGGGGTAGTGCAGTTG
GACGGCAAAATGATTTCGATATCGCCCATTGAGGCGGACACGGGAAGGCCGGCGTTGGCGACGGGCCCCGTGGTT
GCCGGACTGCGCGAGGGTCGTCAAGTGCATGGGGTTGTTGTTGCAGGTAAGAGCAGAGCTTCTCTACCAGGGCGC
GGAATCTCAAGAGAGAAACAAAGAAGAGGAGCTTTTTACTAAGACGGACGACAGTCACACAGACGGAGATTCGCA
TCTTTAAGCCAGCACACTCCAAGGGAGCGTCGAGGGAATTCGACGACGTCTTGTGCGATGCAGCAAGCGTGGTAG
AGCTGGAACTTCAAGGCTACGCCATTGTGGGATTGTTTGGGGACGGGACGGCACGGGCGTTTTCGATTCCCGGGC
TCAAGGATGTTGGCAAGGCGGAGCTGGGCATGGTGGACGGCAGTCGCAGCACGTCGGCGGTTGTGACGGCGACGG
GCGACATCTTTGCATGGACGGGGCCAAGCGAACTGGCCGTGGTGCACGTATGGGGCACGGGCAAGCCGCTGCAAC
AGTCGCCCGACGTGCTCATCAACCCCAAGCTCGAGTGTCCGCCGCGGCCTACGATTTCGGGGCTGCAGTGGATCT
CGGGGACGCAGTACGTGTCGCCGACGGACCTGGACCTGCTGGTGGGCGGGCCCGACCGTCCGCCGAGCAAGCGGA
TGCTGGAAGCGGCGGCGGCAGAGCAGCGGGCGGCGCGGAGTAGGCAAGCCGGGGCGAGTTTGGGAGGGACAGCAG
CGGGGGGTCAGGAGGGCTGGGGAGAGTATCTGACGAGGCAACTGAATGAACGGACGGAGAAGCTCAACATAATGG
GAGATGGCATGGAGAATCTGCAGCAGCAGAGCCAGGGATGGGCGGACGATGTGAATAAGTTTATGGGACGGCAGA
AGCGCAACATTGTGCTTGGGGGGCTCAAGAGCAAGTTTTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail