Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3038
Gene name
LocationContig_222:20943..22274
Strand+
Gene length (bp)1331
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.9E-13 31 345

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4APQ6|TRXR_ARTBC Probable thioredoxin reductase ARB_06224 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06224 PE=1 SV=1 31 370 3.0E-101
sp|Q58931|TRXB_METJA Putative thioredoxin reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1536 PE=3 SV=1 31 332 9.0E-08

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3038
MWLQATALFILSALAGLVQPVPVAEDVATDYDAVIVGGGPSGLAALSALARVRRKALLIDSAEYRNQATRHMHDV
LGFDGVTPAYYRWAARKQIAYYETVDMKNGTVVKIEPLRQPRSNNTYFRVTDRAANGTRCVVTARKVVLGTGLRD
LLPGTPGLRENWGKGIYWCPWCDGHEHADQSLGLLSSLDEVPGLVREILTLNKDIVAFVNGSDTPAMRAATGSKE
PQWEEYLRIHNVRIENATLQAIERLADGGAEHQDPSLPTAPEYDKFNVRLADGRVVERDAFFTSFKNEQASRIGQ
DSGVKLTSGGRLMVDPTKGLVTNIPGVYAIGDANSDNVTNVPHALFSGKRTGVFLHVQLERENAAQELGKVAKRS
IHQEARDLWDHVNGDQGDVLYAGPFDQ*
Coding >OphauG2|3038
ATGTGGCTCCAAGCGACAGCGCTTTTCATTCTGTCGGCACTGGCTGGTCTGGTGCAGCCTGTGCCGGTGGCGGAA
GACGTAGCGACCGATTACGATGCCGTCATTGTAGGCGGTGGCCCTTCGGGCCTGGCTGCTCTCAGTGCTCTGGCC
AGGGTGCGCCGTAAGGCCCTGCTCATTGACTCGGCCGAGTATCGTAACCAGGCGACACGACATATGCATGATGTC
CTGGGGTTTGATGGCGTAACCCCGGCCTATTATCGCTGGGCGGCTCGGAAGCAAATTGCCTACTACGAGACGGTA
GACATGAAGAACGGCACCGTCGTCAAGATTGAGCCGCTGCGCCAGCCCCGGAGTAACAACACCTACTTCCGCGTG
ACGGACAGGGCGGCCAACGGTACGCGGTGCGTCGTCACGGCTCGCAAGGTTGTGCTGGGAACAGGGCTCCGCGAC
CTGCTTCCCGGGACGCCTGGACTGCGCGAGAACTGGGGCAAGGGCATCTACTGGTGTCCGTGGTGCGACGGCCAC
GAGCACGCGGACCAGAGTCTGGGCTTGCTGTCATCGCTCGACGAAGTGCCCGGATTGGTGCGTGAGATATTGACG
CTCAACAAGGACATTGTTGCCTTTGTCAACGGATCCGACACGCCAGCGATGCGAGCTGCAACAGGCAGCAAGGAG
CCCCAGTGGGAGGAATATCTCCGCATCCACAACGTGCGCATCGAGAACGCAACGCTCCAGGCCATTGAGCGGCTG
GCCGATGGCGGTGCCGAGCACCAAGATCCCAGTCTGCCGACAGCGCCCGAGTACGACAAATTCAACGTGCGGCTG
GCAGACGGACGGGTCGTGGAGCGCGACGCCTTTTTCACCAGCTTCAAGAACGAACAAGCATCCCGTATCGGGCAG
GACTCGGGCGTCAAGCTCACCTCGGGCGGCCGCTTGATGGTGGACCCGACCAAGGGTCTCGTCACCAACATCCCC
GGCGTCTATGCCATTGGCGACGCCAACTCGGACAACGTCACCAACGTCCCGCATGCCTTGTTCAGCGGCAAGAGA
ACCGGAGTTTTCCTGCACGTTCAACTGGAGCGGGAGAACGCGGCCCAGGAGCTGGGCAAGGTGGCCAAGCGAAGC
ATCCACCAAGAAGCTCGCGACTTGTGGGACCACGTAAATGGCGACCAAGGCGATGTGCTGTATGCAGGGCCGTTT
GACCAGTGA
Transcript >OphauG2|3038
ATGTGGCTCCAAGCGACAGCGCTTTTCATTCTGTCGGCACTGGCTGGTCTGGTGCAGCCTGTGCCGGTGGCGGAA
GACGTAGCGACCGATTACGATGCCGTCATTGTAGGCGGTGGCCCTTCGGGCCTGGCTGCTCTCAGTGCTCTGGCC
AGGGTGCGCCGTAAGGCCCTGCTCATTGACTCGGCCGAGTATCGTAACCAGGCGACACGACATATGCATGATGTC
CTGGGGTTTGATGGCGTAACCCCGGCCTATTATCGCTGGGCGGCTCGGAAGCAAATTGCCTACTACGAGACGGTA
GACATGAAGAACGGCACCGTCGTCAAGATTGAGCCGCTGCGCCAGCCCCGGAGTAACAACACCTACTTCCGCGTG
ACGGACAGGGCGGCCAACGGTACGCGGTGCGTCGTCACGGCTCGCAAGGTTGTGCTGGGAACAGGGCTCCGCGAC
CTGCTTCCCGGGACGCCTGGACTGCGCGAGAACTGGGGCAAGGGCATCTACTGGTGTCCGTGGTGCGACGGCCAC
GAGCACGCGGACCAGAGTCTGGGCTTGCTGTCATCGCTCGACGAAGTGCCCGGATTGGTGCGTGAGATATTGACG
CTCAACAAGGACATTGTTGCCTTTGTCAACGGATCCGACACGCCAGCGATGCGAGCTGCAACAGGCAGCAAGGAG
CCCCAGTGGGAGGAATATCTCCGCATCCACAACGTGCGCATCGAGAACGCAACGCTCCAGGCCATTGAGCGGCTG
GCCGATGGCGGTGCCGAGCACCAAGATCCCAGTCTGCCGACAGCGCCCGAGTACGACAAATTCAACGTGCGGCTG
GCAGACGGACGGGTCGTGGAGCGCGACGCCTTTTTCACCAGCTTCAAGAACGAACAAGCATCCCGTATCGGGCAG
GACTCGGGCGTCAAGCTCACCTCGGGCGGCCGCTTGATGGTGGACCCGACCAAGGGTCTCGTCACCAACATCCCC
GGCGTCTATGCCATTGGCGACGCCAACTCGGACAACGTCACCAACGTCCCGCATGCCTTGTTCAGCGGCAAGAGA
ACCGGAGTTTTCCTGCACGTTCAACTGGAGCGGGAGAACGCGGCCCAGGAGCTGGGCAAGGTGGCCAAGCGAAGC
ATCCACCAAGAAGCTCGCGACTTGTGGGACCACGTAAATGGCGACCAAGGCGATGTGCTGTATGCAGGGCCGTTT
GACCAGTGA
Gene >OphauG2|3038
ATGTGGCTCCAAGCGACAGCGCTTTTCATTCTGTCGGCACTGGCTGGTCTGGTGCAGCCTGTGCCGGTGGCGGAA
GACGTAGCGACCGATTACGATGCCGTCATTGTAGGCGGTGGCCCTTCGGGCCTGGCTGCTCTCAGTGCTCTGGCC
AGGGTGCGCCGTAAGGCCCTGCTCATTGACTCGGCCGAGTATCGTAACCAGGCGACACGACATATGCATGATGTC
CTGGGGTTTGATGGTGACATGTCCCGAAGCTCCCATGGCCGTGGCATATAGCTGACAAGCGTTGCAACATAGGCG
TAACCCCGGCCTATTATCGCTGGGCGGCTCGGAAGCAAATTGCCTACTACGAGACGGTAGACATGAAGAACGGCA
CCGTCGTCAAGATTGAGCCGCTGCGCCAGCCCCGGAGTAACAACACCTACTTCCGCGTGACGGACAGGGCGGCCA
ACGGTACGCGGTGCGTCGTCACGGCTCGCAAGGTTGTGCTGGGAACAGGGCTCCGCGACCTGCTTCCCGGGACGC
CTGGACTGCGCGAGAACTGGGGCAAGGGCATCTACTGGTGTCCGTGGTGCGACGGCCACGAGCACGCGGACCAGA
GTCTGGGCTTGCTGTCATCGCTCGACGAAGTGCCCGGATTGGTGCGTGAGATATTGACGCTCAACAAGGACATTG
TTGCCTTTGTCAACGGATCCGACACGCCAGCGATGCGAGCTGCAACAGGCAGCAAGGAGCCCCAGTGGGAGGAAT
ATCTCCGCATCCACAACGTGCGCATCGAGAACGCAACGCTCCAGGCCATTGAGCGGCTGGCCGATGGCGGTGCCG
AGCACCAAGATCCCAGTCTGCCGACAGCGCCCGAGTACGACAAATTCAACGTGCGGCTGGCAGACGGACGGGTCG
TGGAGCGCGACGCCTTTTTCACCAGCTTCAAGAACGAACAAGCATCCCGTATCGGGCAGGACTCGGGCGTCAAGC
TCACCTCGGGCGGCCGCTTGATGGTGGACCCGACCAAGGGTCTCGTCACCAACATCCCCGGCGTCTATGCCATTG
GCGACGCCAACTCGGACAACGTCACCAACGTCCCGCATGCCTTGTTCAGCGGCAAGAGAACCGGAGTTTTCCTGC
ACGGTAAGCCTCATTTCGCATGCTGGGCAAAAACAGCCAGAGTAGTTTGCTAACTGCCCATGGCAGTTCAACTGG
AGCGGGAGAACGCGGCCCAGGAGCTGGGCAAGGTGGCCAAGCGAAGCATCCACCAAGAAGCTCGCGACTTGTGGG
ACCACGTAAATGGCGACCAAGGCGATGTGCTGTATGCAGGGCCGTTTGACCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail