Protein ID | OphauG2|3032 |
Gene name | |
Location | Contig_222:9644..10712 |
Strand | - |
Gene length (bp) | 1068 |
Transcript length (bp) | 1068 |
Coding sequence length (bp) | 1068 |
Protein length (aa) | 356 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF02569 | Pantoate_ligase | Pantoate-beta-alanine ligase | 3.3E-93 | 25 | 351 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|A7NG78|PANC_ROSCS | Pantothenate synthetase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=panC PE=3 SV=1 | 23 | 353 | 4.0E-76 |
sp|A5URA7|PANC_ROSS1 | Pantothenate synthetase OS=Roseiflexus sp. (strain RS-1) GN=panC PE=3 SV=1 | 23 | 353 | 3.0E-71 |
sp|B9LIH9|PANC_CHLSY | Pantothenate synthetase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=panC PE=3 SV=1 | 46 | 353 | 2.0E-69 |
sp|A9WFR6|PANC_CHLAA | Pantothenate synthetase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=panC PE=3 SV=1 | 46 | 353 | 2.0E-69 |
sp|A9B3W0|PANC_HERA2 | Pantothenate synthetase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=panC PE=3 SV=1 | 23 | 352 | 7.0E-69 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|A7NG78|PANC_ROSCS | Pantothenate synthetase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=panC PE=3 SV=1 | 23 | 353 | 4.0E-76 |
sp|A5URA7|PANC_ROSS1 | Pantothenate synthetase OS=Roseiflexus sp. (strain RS-1) GN=panC PE=3 SV=1 | 23 | 353 | 3.0E-71 |
sp|B9LIH9|PANC_CHLSY | Pantothenate synthetase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=panC PE=3 SV=1 | 46 | 353 | 2.0E-69 |
sp|A9WFR6|PANC_CHLAA | Pantothenate synthetase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=panC PE=3 SV=1 | 46 | 353 | 2.0E-69 |
sp|A9B3W0|PANC_HERA2 | Pantothenate synthetase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=panC PE=3 SV=1 | 23 | 352 | 7.0E-69 |
sp|Q2RM60|PANC_MOOTA | Pantothenate synthetase OS=Moorella thermoacetica (strain ATCC 39073) GN=panC PE=3 SV=1 | 23 | 353 | 8.0E-69 |
sp|B0TBP5|PANC_HELMI | Pantothenate synthetase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=panC PE=3 SV=1 | 23 | 353 | 1.0E-67 |
sp|Q0B0P5|PANC_SYNWW | Pantothenate synthetase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=panC PE=3 SV=1 | 23 | 353 | 9.0E-67 |
sp|B8G643|PANC_CHLAD | Pantothenate synthetase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=panC PE=3 SV=1 | 45 | 352 | 1.0E-66 |
sp|Q9X0G6|PANC_THEMA | Pantothenate synthetase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=panC PE=1 SV=1 | 23 | 352 | 1.0E-65 |
sp|P40459|PANC_YEAST | Pantoate--beta-alanine ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN6 PE=1 SV=2 | 23 | 352 | 1.0E-65 |
sp|Q1IHA8|PANC_KORVE | Pantothenate synthetase OS=Koribacter versatilis (strain Ellin345) GN=panC PE=3 SV=1 | 23 | 353 | 2.0E-65 |
sp|A5IN99|PANC_THEP1 | Pantothenate synthetase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=panC PE=3 SV=1 | 23 | 352 | 3.0E-65 |
sp|A3DDV6|PANC_CLOTH | Pantothenate synthetase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=panC PE=3 SV=1 | 23 | 353 | 3.0E-65 |
sp|B1L843|PANC_THESQ | Pantothenate synthetase OS=Thermotoga sp. (strain RQ2) GN=panC PE=3 SV=1 | 23 | 352 | 3.0E-65 |
sp|O86953|PANC_THENE | Pantothenate synthetase OS=Thermotoga neapolitana GN=panC PE=3 SV=1 | 23 | 311 | 4.0E-65 |
sp|C1F8U3|PANC_ACIC5 | Pantothenate synthetase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=panC PE=3 SV=1 | 14 | 352 | 1.0E-64 |
sp|A5D5T5|PANC_PELTS | Pantothenate synthetase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=panC PE=3 SV=1 | 25 | 352 | 2.0E-64 |
sp|Q833S6|PANC_ENTFA | Pantothenate synthetase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=panC PE=3 SV=1 | 25 | 313 | 4.0E-64 |
sp|A8F7T6|PANC_PSELT | Pantothenate synthetase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=panC PE=3 SV=1 | 25 | 352 | 9.0E-64 |
sp|B9ML77|PANC_CALBD | Pantothenate synthetase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=panC PE=3 SV=1 | 25 | 353 | 8.0E-62 |
sp|A5FR69|PANC_DEHMB | Pantothenate synthetase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=panC PE=3 SV=1 | 23 | 320 | 2.0E-61 |
sp|Q9AMR9|PANC1_BRADU | Pantothenate synthetase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=panC1 PE=3 SV=1 | 43 | 352 | 3.0E-61 |
sp|Q251P2|PANC_DESHY | Pantothenate synthetase OS=Desulfitobacterium hafniense (strain Y51) GN=panC PE=3 SV=1 | 25 | 311 | 5.0E-61 |
sp|B8FZE0|PANC_DESHD | Pantothenate synthetase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=panC PE=3 SV=1 | 25 | 311 | 5.0E-61 |
sp|B7IE21|PANC_THEAB | Pantothenate synthetase OS=Thermosipho africanus (strain TCF52B) GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-60 |
sp|Q8CR21|PANC_STAES | Pantothenate synthetase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=panC PE=3 SV=1 | 24 | 267 | 2.0E-60 |
sp|Q5HL36|PANC_STAEQ | Pantothenate synthetase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=panC PE=3 SV=1 | 24 | 267 | 2.0E-60 |
sp|B0KC91|PANC_THEP3 | Pantothenate synthetase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=panC PE=3 SV=1 | 28 | 310 | 6.0E-60 |
sp|B0K364|PANC_THEPX | Pantothenate synthetase OS=Thermoanaerobacter sp. (strain X514) GN=panC PE=3 SV=1 | 37 | 310 | 6.0E-60 |
sp|Q2LSQ5|PANC_SYNAS | Pantothenate synthetase OS=Syntrophus aciditrophicus (strain SB) GN=panC PE=3 SV=2 | 23 | 311 | 8.0E-60 |
sp|Q9PIK2|PANC_CAMJE | Pantothenate synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=panC PE=1 SV=1 | 35 | 317 | 9.0E-60 |
sp|A8FK86|PANC_CAMJ8 | Pantothenate synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=panC PE=3 SV=1 | 35 | 317 | 9.0E-60 |
sp|B8I2Z3|PANC_CLOCE | Pantothenate synthetase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=panC PE=3 SV=1 | 22 | 311 | 2.0E-59 |
sp|A7H575|PANC_CAMJD | Pantothenate synthetase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=panC PE=3 SV=1 | 21 | 317 | 3.0E-59 |
sp|Q3A9L1|PANC_CARHZ | Pantothenate synthetase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=panC PE=3 SV=1 | 23 | 353 | 5.0E-59 |
sp|Q3ILL1|PANC_PSEHT | Pantothenate synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=panC PE=3 SV=1 | 21 | 353 | 1.0E-58 |
sp|A8LKA2|PANC_DINSH | Pantothenate synthetase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=panC PE=3 SV=1 | 25 | 321 | 2.0E-58 |
sp|Q3ZXF9|PANC_DEHMC | Pantothenate synthetase OS=Dehalococcoides mccartyi (strain CBDB1) GN=panC PE=3 SV=1 | 46 | 320 | 3.0E-58 |
sp|Q9ZEP7|PANC_PSEFS | Pantothenate synthetase OS=Pseudomonas fluorescens (strain SBW25) GN=panC PE=3 SV=2 | 44 | 267 | 4.0E-58 |
sp|A6WW03|PANC_OCHA4 | Pantothenate synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=panC PE=3 SV=1 | 23 | 268 | 4.0E-58 |
sp|B5YJ91|PANC_THEYD | Pantothenate synthetase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=panC PE=3 SV=1 | 23 | 353 | 5.0E-58 |
sp|A1VY17|PANC_CAMJJ | Pantothenate synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=panC PE=3 SV=1 | 35 | 317 | 5.0E-58 |
sp|Q5FQ88|PANC_GLUOX | Pantothenate synthetase OS=Gluconobacter oxydans (strain 621H) GN=panC PE=3 SV=1 | 43 | 352 | 6.0E-58 |
sp|A7HND1|PANC_FERNB | Pantothenate synthetase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=panC PE=3 SV=1 | 23 | 352 | 6.0E-58 |
sp|Q5HWH4|PANC_CAMJR | Pantothenate synthetase OS=Campylobacter jejuni (strain RM1221) GN=panC PE=3 SV=1 | 23 | 317 | 8.0E-58 |
sp|Q3A3I7|PANC_PELCD | Pantothenate synthetase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=panC PE=3 SV=1 | 46 | 322 | 8.0E-58 |
sp|C6E3N5|PANC_GEOSM | Pantothenate synthetase OS=Geobacter sp. (strain M21) GN=panC PE=3 SV=1 | 25 | 352 | 8.0E-58 |
sp|B5E845|PANC_GEOBB | Pantothenate synthetase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=panC PE=3 SV=1 | 25 | 352 | 9.0E-58 |
sp|Q8G2J0|PANC_BRUSU | Pantothenate synthetase OS=Brucella suis biovar 1 (strain 1330) GN=panC PE=3 SV=1 | 23 | 268 | 9.0E-58 |
sp|A9M8B2|PANC_BRUC2 | Pantothenate synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=panC PE=3 SV=1 | 23 | 268 | 9.0E-58 |
sp|B0CJW0|PANC_BRUSI | Pantothenate synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=panC PE=3 SV=1 | 23 | 268 | 1.0E-57 |
sp|A5VNS0|PANC_BRUO2 | Pantothenate synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=panC PE=3 SV=1 | 23 | 268 | 1.0E-57 |
sp|Q8YFC9|PANC_BRUME | Pantothenate synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=panC PE=1 SV=1 | 23 | 268 | 1.0E-57 |
sp|C0RH45|PANC_BRUMB | Pantothenate synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=panC PE=3 SV=1 | 23 | 268 | 1.0E-57 |
sp|Q57F30|PANC_BRUAB | Pantothenate synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=panC PE=3 SV=1 | 23 | 268 | 1.0E-57 |
sp|Q2YPI2|PANC_BRUA2 | Pantothenate synthetase OS=Brucella abortus (strain 2308) GN=panC PE=3 SV=1 | 23 | 268 | 1.0E-57 |
sp|B2S9H8|PANC_BRUA1 | Pantothenate synthetase OS=Brucella abortus (strain S19) GN=panC PE=3 SV=1 | 23 | 268 | 1.0E-57 |
sp|A4XMZ3|PANC_CALS8 | Pantothenate synthetase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=panC PE=3 SV=1 | 44 | 353 | 1.0E-57 |
sp|A6LNF3|PANC_THEM4 | Pantothenate synthetase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-57 |
sp|Q88DW8|PANC_PSEPK | Pantothenate synthetase OS=Pseudomonas putida (strain KT2440) GN=panC PE=3 SV=1 | 44 | 267 | 2.0E-57 |
sp|Q3Z8B3|PANC_DEHM1 | Pantothenate synthetase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=panC PE=3 SV=1 | 46 | 320 | 2.0E-57 |
sp|Q7VK57|PANC_HELHP | Pantothenate synthetase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-57 |
sp|Q888Q6|PANC_PSESM | Pantothenate synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=panC PE=3 SV=1 | 44 | 312 | 3.0E-57 |
sp|B2V652|PANC_SULSY | Pantothenate synthetase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=panC PE=3 SV=1 | 44 | 322 | 3.0E-57 |
sp|Q7UTQ8|PANC_RHOBA | Pantothenate synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=panC PE=3 SV=1 | 23 | 297 | 4.0E-57 |
sp|A5W975|PANC_PSEP1 | Pantothenate synthetase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=panC PE=3 SV=1 | 44 | 267 | 4.0E-57 |
sp|B4RYN9|PANC_ALTMD | Pantothenate synthetase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=panC1 PE=3 SV=1 | 23 | 265 | 4.0E-57 |
sp|A6UB63|PANC_SINMW | Pantothenate synthetase OS=Sinorhizobium medicae (strain WSM419) GN=panC PE=3 SV=1 | 44 | 265 | 5.0E-57 |
sp|A7GAI5|PANC_CLOBL | Pantothenate synthetase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=panC PE=3 SV=1 | 23 | 305 | 5.0E-57 |
sp|Q47KV5|PANC_THEFY | Pantothenate synthetase OS=Thermobifida fusca (strain YX) GN=panC PE=3 SV=1 | 46 | 258 | 6.0E-57 |
sp|B0KHW5|PANC_PSEPG | Pantothenate synthetase OS=Pseudomonas putida (strain GB-1) GN=panC PE=3 SV=1 | 44 | 267 | 6.0E-57 |
sp|B1KUY6|PANC_CLOBM | Pantothenate synthetase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=panC PE=3 SV=1 | 22 | 305 | 1.0E-56 |
sp|A1TYE5|PANC_MARHV | Pantothenate synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=panC PE=3 SV=1 | 23 | 286 | 1.0E-56 |
sp|Q74CG7|PANC_GEOSL | Pantothenate synthetase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=panC PE=3 SV=1 | 23 | 265 | 1.0E-56 |
sp|Q6LMJ5|PANC_PHOPR | Pantothenate synthetase OS=Photobacterium profundum GN=panC PE=3 SV=1 | 30 | 287 | 1.0E-56 |
sp|Q8UA92|PANC_AGRFC | Pantothenate synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=panC PE=3 SV=2 | 23 | 268 | 2.0E-56 |
sp|O67891|PANC_AQUAE | Pantothenate synthetase OS=Aquifex aeolicus (strain VF5) GN=panC PE=3 SV=1 | 25 | 324 | 2.0E-56 |
sp|B1IEL5|PANC_CLOBK | Pantothenate synthetase OS=Clostridium botulinum (strain Okra / Type B1) GN=panC PE=3 SV=1 | 23 | 310 | 3.0E-56 |
sp|A4SJ60|PANC_AERS4 | Pantothenate synthetase OS=Aeromonas salmonicida (strain A449) GN=panC PE=3 SV=1 | 30 | 269 | 3.0E-56 |
sp|Q8DG73|PANCY_THEEB | Bifunctional pantoate ligase/cytidylate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=panC/cmk PE=3 SV=1 | 45 | 353 | 4.0E-56 |
sp|B5Y863|PANC_COPPD | Pantothenate synthetase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=panC PE=3 SV=1 | 23 | 353 | 4.0E-56 |
sp|A7FR59|PANC_CLOB1 | Pantothenate synthetase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=panC PE=3 SV=1 | 23 | 310 | 7.0E-56 |
sp|C0QHN3|PANC_DESAH | Pantothenate synthetase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=panC PE=3 SV=1 | 25 | 310 | 7.0E-56 |
sp|Q2JZU1|PANC_RHIEC | Pantothenate synthetase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=panC PE=3 SV=1 | 23 | 267 | 8.0E-56 |
sp|C1FS96|PANC_CLOBJ | Pantothenate synthetase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=panC PE=3 SV=1 | 23 | 310 | 9.0E-56 |
sp|Q48N87|PANC_PSE14 | Pantothenate synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=panC PE=3 SV=1 | 23 | 305 | 9.0E-56 |
sp|C3L034|PANC_CLOB6 | Pantothenate synthetase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=panC PE=3 SV=1 | 23 | 310 | 1.0E-55 |
sp|Q1I4P1|PANC_PSEE4 | Pantothenate synthetase OS=Pseudomonas entomophila (strain L48) GN=panC PE=3 SV=1 | 44 | 267 | 1.0E-55 |
sp|B9DKF5|PANC_STACT | Pantothenate synthetase OS=Staphylococcus carnosus (strain TM300) GN=panC PE=3 SV=1 | 24 | 268 | 1.0E-55 |
sp|B1KEP7|PANC_SHEWM | Pantothenate synthetase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=panC PE=3 SV=1 | 18 | 258 | 2.0E-55 |
sp|A0LF67|PANC_SYNFM | Pantothenate synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=panC PE=3 SV=1 | 23 | 311 | 2.0E-55 |
sp|C1DFJ9|PANC_AZOVD | Pantothenate synthetase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=panC PE=3 SV=1 | 42 | 286 | 2.0E-55 |
sp|Q2YWG0|PANC_STAAB | Pantothenate synthetase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=panC PE=3 SV=1 | 24 | 266 | 3.0E-55 |
sp|Q5QVR4|PANC_IDILO | Pantothenate synthetase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=panC PE=3 SV=1 | 23 | 306 | 3.0E-55 |
sp|B5FB06|PANC_VIBFM | Pantothenate synthetase OS=Vibrio fischeri (strain MJ11) GN=panC PE=3 SV=1 | 30 | 353 | 4.0E-55 |
sp|Q92NN0|PANC_RHIME | Pantothenate synthetase OS=Rhizobium meliloti (strain 1021) GN=panC PE=3 SV=1 | 44 | 263 | 6.0E-55 |
sp|B9JXS2|PANC_AGRVS | Pantothenate synthetase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=panC PE=3 SV=1 | 23 | 268 | 6.0E-55 |
sp|A7MYX3|PANC_VIBCB | Pantothenate synthetase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=panC PE=3 SV=1 | 44 | 287 | 6.0E-55 |
sp|Q6GDK5|PANC_STAAR | Pantothenate synthetase OS=Staphylococcus aureus (strain MRSA252) GN=panC PE=1 SV=1 | 24 | 266 | 7.0E-55 |
sp|Q4K5Y3|PANC_PSEF5 | Pantothenate synthetase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=panC PE=3 SV=1 | 21 | 267 | 7.0E-55 |
sp|Q2FV22|PANC_STAA8 | Pantothenate synthetase OS=Staphylococcus aureus (strain NCTC 8325) GN=panC PE=1 SV=1 | 24 | 266 | 7.0E-55 |
sp|Q8NUN2|PANC_STAAW | Pantothenate synthetase OS=Staphylococcus aureus (strain MW2) GN=panC PE=3 SV=1 | 24 | 266 | 9.0E-55 |
sp|Q6G678|PANC_STAAS | Pantothenate synthetase OS=Staphylococcus aureus (strain MSSA476) GN=panC PE=3 SV=1 | 24 | 266 | 9.0E-55 |
sp|A8Z3J8|PANC_STAAT | Pantothenate synthetase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=panC PE=3 SV=1 | 24 | 266 | 1.0E-54 |
sp|A6QK85|PANC_STAAE | Pantothenate synthetase OS=Staphylococcus aureus (strain Newman) GN=panC PE=3 SV=1 | 24 | 266 | 1.0E-54 |
sp|Q5HCV4|PANC_STAAC | Pantothenate synthetase OS=Staphylococcus aureus (strain COL) GN=panC PE=3 SV=1 | 24 | 266 | 1.0E-54 |
sp|Q2FDR1|PANC_STAA3 | Pantothenate synthetase OS=Staphylococcus aureus (strain USA300) GN=panC PE=3 SV=1 | 24 | 266 | 1.0E-54 |
sp|B1J2C1|PANC_PSEPW | Pantothenate synthetase OS=Pseudomonas putida (strain W619) GN=panC PE=3 SV=1 | 44 | 267 | 1.0E-54 |
sp|Q5E2T1|PANC_VIBF1 | Pantothenate synthetase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=panC PE=3 SV=1 | 30 | 353 | 1.0E-54 |
sp|B7V1E2|PANC_PSEA8 | Pantothenate synthetase OS=Pseudomonas aeruginosa (strain LESB58) GN=panC PE=3 SV=1 | 21 | 286 | 1.0E-54 |
sp|A1AUV7|PANC_PELPD | Pantothenate synthetase OS=Pelobacter propionicus (strain DSM 2379) GN=panC PE=3 SV=1 | 23 | 305 | 1.0E-54 |
sp|Q12JC5|PANC_SHEDO | Pantothenate synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=panC PE=3 SV=1 | 18 | 305 | 1.0E-54 |
sp|A1US39|PANC_BARBK | Pantothenate synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=panC PE=3 SV=1 | 23 | 279 | 2.0E-54 |
sp|Q9HV69|PANC_PSEAE | Pantothenate synthetase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=panC PE=3 SV=1 | 21 | 286 | 2.0E-54 |
sp|Q02FU2|PANC_PSEAB | Pantothenate synthetase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=panC PE=3 SV=1 | 21 | 286 | 2.0E-54 |
sp|Q87LV1|PANC_VIBPA | Pantothenate synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=panC PE=3 SV=1 | 44 | 287 | 2.0E-54 |
sp|Q07L39|PANC_RHOP5 | Pantothenate synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=panC PE=3 SV=2 | 20 | 258 | 2.0E-54 |
sp|Q1AT82|PANC_RUBXD | Pantothenate synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=panC PE=3 SV=1 | 19 | 307 | 2.0E-54 |
sp|Q1GNR4|PANC_SPHAL | Pantothenate synthetase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=panC PE=3 SV=1 | 23 | 309 | 2.0E-54 |
sp|B9JH26|PANC_AGRRK | Pantothenate synthetase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=panC PE=3 SV=1 | 44 | 305 | 2.0E-54 |
sp|Q7MHV3|PANC_VIBVY | Pantothenate synthetase OS=Vibrio vulnificus (strain YJ016) GN=panC PE=3 SV=1 | 44 | 287 | 2.0E-54 |
sp|Q1J0L2|PANC_DEIGD | Pantothenate synthetase OS=Deinococcus geothermalis (strain DSM 11300) GN=panC PE=3 SV=1 | 21 | 354 | 2.0E-54 |
sp|Q1DAN8|PANC_MYXXD | Pantothenate synthetase OS=Myxococcus xanthus (strain DK 1622) GN=panC PE=3 SV=1 | 25 | 316 | 2.0E-54 |
sp|Q4ZY87|PANC_PSEU2 | Pantothenate synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=panC PE=3 SV=1 | 44 | 305 | 2.0E-54 |
sp|Q18C33|PANC_PEPD6 | Pantothenate synthetase OS=Peptoclostridium difficile (strain 630) GN=panC PE=3 SV=1 | 23 | 305 | 3.0E-54 |
sp|A0KP08|PANC_AERHH | Pantothenate synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=panC PE=3 SV=1 | 35 | 269 | 3.0E-54 |
sp|Q8DC12|PANC_VIBVU | Pantothenate synthetase OS=Vibrio vulnificus (strain CMCP6) GN=panC PE=3 SV=1 | 44 | 287 | 3.0E-54 |
sp|P65659|PANC_STAAN | Pantothenate synthetase OS=Staphylococcus aureus (strain N315) GN=panC PE=1 SV=1 | 24 | 266 | 4.0E-54 |
sp|P65658|PANC_STAAM | Pantothenate synthetase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=panC PE=3 SV=1 | 24 | 266 | 4.0E-54 |
sp|A5IW23|PANC_STAA9 | Pantothenate synthetase OS=Staphylococcus aureus (strain JH9) GN=panC PE=3 SV=1 | 24 | 266 | 4.0E-54 |
sp|A6U4X8|PANC_STAA2 | Pantothenate synthetase OS=Staphylococcus aureus (strain JH1) GN=panC PE=3 SV=1 | 24 | 266 | 4.0E-54 |
sp|A7X6X6|PANC_STAA1 | Pantothenate synthetase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=panC PE=3 SV=1 | 24 | 266 | 4.0E-54 |
sp|A6VCI6|PANC_PSEA7 | Pantothenate synthetase OS=Pseudomonas aeruginosa (strain PA7) GN=panC PE=3 SV=1 | 21 | 286 | 4.0E-54 |
sp|Q5SHF5|PANC_THET8 | Pantothenate synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=panC PE=1 SV=1 | 23 | 354 | 4.0E-54 |
sp|Q72HS0|PANC_THET2 | Pantothenate synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=panC PE=3 SV=1 | 23 | 354 | 4.0E-54 |
sp|A1SDW7|PANC_NOCSJ | Pantothenate synthetase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=panC PE=3 SV=1 | 46 | 312 | 4.0E-54 |
sp|A0L0R3|PANC_SHESA | Pantothenate synthetase OS=Shewanella sp. (strain ANA-3) GN=panC PE=3 SV=1 | 29 | 233 | 4.0E-54 |
sp|B7VK04|PANC_VIBTL | Pantothenate synthetase OS=Vibrio tasmaniensis (strain LGP32) GN=panC PE=3 SV=1 | 44 | 320 | 5.0E-54 |
sp|B0TTI1|PANC_SHEHH | Pantothenate synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=panC PE=3 SV=1 | 18 | 311 | 6.0E-54 |
sp|B5Z6E3|PANC_HELPG | Pantothenate synthetase OS=Helicobacter pylori (strain G27) GN=panC PE=3 SV=1 | 23 | 321 | 9.0E-54 |
sp|Q1QSZ8|PANC_CHRSD | Pantothenate synthetase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=panC PE=3 SV=1 | 44 | 259 | 1.0E-53 |
sp|Q1CVE9|PANC_HELPH | Pantothenate synthetase OS=Helicobacter pylori (strain HPAG1) GN=panC PE=3 SV=1 | 23 | 321 | 1.0E-53 |
sp|C4L930|PANC_TOLAT | Pantothenate synthetase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=panC PE=3 SV=1 | 25 | 248 | 1.0E-53 |
sp|A8G085|PANC_SHESH | Pantothenate synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=panC PE=3 SV=1 | 44 | 259 | 1.0E-53 |
sp|Q9FKB3|PANC_ARATH | Pantoate--beta-alanine ligase OS=Arabidopsis thaliana GN=At5g48840 PE=1 SV=1 | 25 | 350 | 1.0E-53 |
sp|A0PV50|PANC_MYCUA | Pantothenate synthetase OS=Mycobacterium ulcerans (strain Agy99) GN=panC PE=3 SV=1 | 44 | 353 | 2.0E-53 |
sp|B3QSB4|PANC_CHLT3 | Pantothenate synthetase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=panC PE=3 SV=1 | 23 | 305 | 2.0E-53 |
sp|A8H0D3|PANC_SHEPA | Pantothenate synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=panC PE=3 SV=1 | 18 | 258 | 2.0E-53 |
sp|B8CTC7|PANC_SHEPW | Pantothenate synthetase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=panC PE=3 SV=1 | 18 | 260 | 2.0E-53 |
sp|A4XYC5|PANC_PSEMY | Pantothenate synthetase OS=Pseudomonas mendocina (strain ymp) GN=panC PE=3 SV=1 | 21 | 353 | 2.0E-53 |
sp|Q8EIH0|PANC_SHEON | Pantothenate synthetase OS=Shewanella oneidensis (strain MR-1) GN=panC PE=3 SV=1 | 18 | 233 | 2.0E-53 |
sp|Q4LA34|PANC_STAHJ | Pantothenate synthetase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=panC PE=3 SV=1 | 24 | 259 | 2.0E-53 |
sp|A1RG66|PANC_SHESW | Pantothenate synthetase OS=Shewanella sp. (strain W3-18-1) GN=panC PE=3 SV=1 | 18 | 233 | 2.0E-53 |
sp|A4YA62|PANC_SHEPC | Pantothenate synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=panC PE=3 SV=1 | 18 | 233 | 2.0E-53 |
sp|B6JPA5|PANC_HELP2 | Pantothenate synthetase OS=Helicobacter pylori (strain P12) GN=panC PE=3 SV=1 | 23 | 321 | 3.0E-53 |
sp|Q3K6Q5|PANC_PSEPF | Pantothenate synthetase OS=Pseudomonas fluorescens (strain Pf0-1) GN=panC PE=3 SV=1 | 44 | 286 | 4.0E-53 |
sp|A0PXQ4|PANC_CLONN | Pantothenate synthetase OS=Clostridium novyi (strain NT) GN=panC PE=3 SV=1 | 45 | 311 | 8.0E-53 |
sp|A0L3M5|PANC_MAGMM | Pantothenate synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=panC PE=3 SV=1 | 31 | 352 | 9.0E-53 |
sp|A5VA26|PANC_SPHWW | Pantothenate synthetase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=panC PE=3 SV=1 | 23 | 354 | 1.0E-52 |
sp|Q0HMB2|PANC_SHESM | Pantothenate synthetase OS=Shewanella sp. (strain MR-4) GN=panC PE=3 SV=1 | 18 | 233 | 1.0E-52 |
sp|C3LS81|PANC_VIBCM | Pantothenate synthetase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=panC PE=3 SV=1 | 44 | 287 | 1.0E-52 |
sp|Q9KUD1|PANC_VIBCH | Pantothenate synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=panC PE=3 SV=1 | 44 | 287 | 1.0E-52 |
sp|A5F974|PANC_VIBC3 | Pantothenate synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=panC PE=3 SV=1 | 44 | 287 | 1.0E-52 |
sp|Q0HRH5|PANC_SHESR | Pantothenate synthetase OS=Shewanella sp. (strain MR-7) GN=panC PE=3 SV=1 | 18 | 233 | 2.0E-52 |
sp|Q55074|PANCY_SYNY3 | Bifunctional pantoate ligase/cytidylate kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=panC/cmk PE=3 SV=2 | 23 | 352 | 2.0E-52 |
sp|B8EDX3|PANC_SHEB2 | Pantothenate synthetase OS=Shewanella baltica (strain OS223) GN=panC PE=3 SV=1 | 18 | 259 | 2.0E-52 |
sp|Q5Z2U3|PANC_NOCFA | Pantothenate synthetase OS=Nocardia farcinica (strain IFM 10152) GN=panC PE=3 SV=1 | 44 | 233 | 2.0E-52 |
sp|Q2JRH9|PANCY_SYNJA | Bifunctional pantoate ligase/cytidylate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=panC/cmk PE=3 SV=1 | 23 | 354 | 2.0E-52 |
sp|C5D3B2|PANC_GEOSW | Pantothenate synthetase OS=Geobacillus sp. (strain WCH70) GN=panC PE=3 SV=1 | 25 | 308 | 3.0E-52 |
sp|Q97F38|PANC_CLOAB | Pantothenate synthetase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=panC PE=3 SV=1 | 23 | 310 | 3.0E-52 |
sp|Q17Z21|PANC_HELAH | Pantothenate synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=panC PE=3 SV=1 | 23 | 321 | 3.0E-52 |
sp|Q1GLQ5|PANC_RUEST | Pantothenate synthetase OS=Ruegeria sp. (strain TM1040) GN=panC PE=3 SV=1 | 25 | 314 | 3.0E-52 |
sp|A6WJK9|PANC_SHEB8 | Pantothenate synthetase OS=Shewanella baltica (strain OS185) GN=panC PE=3 SV=1 | 18 | 259 | 4.0E-52 |
sp|A3D8A9|PANC_SHEB5 | Pantothenate synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=panC PE=3 SV=1 | 18 | 259 | 4.0E-52 |
sp|Q39V50|PANC_GEOMG | Pantothenate synthetase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=panC PE=3 SV=1 | 23 | 352 | 5.0E-52 |
sp|A9L2H4|PANC_SHEB9 | Pantothenate synthetase OS=Shewanella baltica (strain OS195) GN=panC PE=3 SV=1 | 18 | 259 | 5.0E-52 |
sp|O24035|PANC_LOTJA | Pantoate--beta-alanine ligase OS=Lotus japonicus GN=PANC PE=1 SV=3 | 25 | 310 | 6.0E-52 |
sp|A1S3M6|PANC_SHEAM | Pantothenate synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=panC PE=3 SV=1 | 29 | 233 | 6.0E-52 |
sp|Q54I80|PANC_DICDI | Pantoate--beta-alanine ligase OS=Dictyostelium discoideum GN=panC PE=3 SV=1 | 46 | 352 | 7.0E-52 |
sp|B9M2A2|PANC_GEODF | Pantothenate synthetase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=panC PE=3 SV=1 | 23 | 324 | 8.0E-52 |
sp|Q1LTN0|PANC_BAUCH | Pantothenate synthetase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=panC PE=3 SV=1 | 22 | 269 | 9.0E-52 |
sp|B6ELE2|PANC_ALISL | Pantothenate synthetase OS=Aliivibrio salmonicida (strain LFI1238) GN=panC PE=3 SV=1 | 30 | 353 | 9.0E-52 |
sp|Q31FF6|PANC_THICR | Pantothenate synthetase OS=Thiomicrospira crunogena (strain XCL-2) GN=panC PE=3 SV=1 | 30 | 352 | 1.0E-51 |
sp|B0C6S1|PANCY_ACAM1 | Bifunctional pantoate ligase/cytidylate kinase OS=Acaryochloris marina (strain MBIC 11017) GN=panC/cmk PE=3 SV=1 | 22 | 353 | 1.0E-51 |
sp|Q1M4A1|PANC_RHIL3 | Pantothenate synthetase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=panC PE=3 SV=1 | 23 | 267 | 1.0E-51 |
sp|P56061|PANC_HELPY | Pantothenate synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=panC PE=3 SV=1 | 23 | 321 | 1.0E-51 |
sp|P9WIL5|PANC_MYCTU | Pantothenate synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=panC PE=1 SV=1 | 41 | 238 | 1.0E-51 |
sp|P9WIL4|PANC_MYCTO | Pantothenate synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=panC PE=1 SV=1 | 41 | 238 | 1.0E-51 |
sp|A5U8S7|PANC_MYCTA | Pantothenate synthetase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=panC PE=3 SV=1 | 41 | 238 | 1.0E-51 |
sp|A1KPT7|PANC_MYCBP | Pantothenate synthetase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=panC PE=3 SV=1 | 41 | 238 | 1.0E-51 |
sp|P0A5R1|PANC_MYCBO | Pantothenate synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=panC PE=3 SV=1 | 41 | 238 | 1.0E-51 |
sp|Q2S8W2|PANC_HAHCH | Pantothenate synthetase OS=Hahella chejuensis (strain KCTC 2396) GN=panC PE=3 SV=1 | 26 | 297 | 1.0E-51 |
sp|C6DC48|PANC_PECCP | Pantothenate synthetase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=panC PE=3 SV=1 | 32 | 320 | 2.0E-51 |
sp|Q8YSZ3|PANCY_NOSS1 | Bifunctional pantoate ligase/cytidylate kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=panC/cmk PE=3 SV=1 | 29 | 310 | 2.0E-51 |
sp|Q3Z5M7|PANC_SHISS | Pantothenate synthetase OS=Shigella sonnei (strain Ss046) GN=panC PE=3 SV=1 | 25 | 297 | 2.0E-51 |
sp|Q326A4|PANC_SHIBS | Pantothenate synthetase OS=Shigella boydii serotype 4 (strain Sb227) GN=panC PE=3 SV=1 | 25 | 297 | 2.0E-51 |
sp|B2U2Y0|PANC_SHIB3 | Pantothenate synthetase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=panC PE=3 SV=1 | 25 | 297 | 2.0E-51 |
sp|B5YZH0|PANC_ECO5E | Pantothenate synthetase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=panC PE=3 SV=1 | 25 | 297 | 2.0E-51 |
sp|Q8X930|PANC_ECO57 | Pantothenate synthetase OS=Escherichia coli O157:H7 GN=panC PE=3 SV=1 | 25 | 297 | 2.0E-51 |
sp|Q8CX59|PANC_OCEIH | Pantothenate synthetase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=panC PE=3 SV=1 | 26 | 270 | 2.0E-51 |
sp|Q5N530|PANCY_SYNP6 | Bifunctional pantoate ligase/cytidylate kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=panC/cmk PE=3 SV=1 | 23 | 262 | 2.0E-51 |
sp|Q31P38|PANCY_SYNE7 | Bifunctional pantoate ligase/cytidylate kinase OS=Synechococcus elongatus (strain PCC 7942) GN=panC/cmk PE=3 SV=1 | 23 | 262 | 2.0E-51 |
sp|C4XPZ7|PANC_DESMR | Pantothenate synthetase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=panC PE=3 SV=1 | 23 | 324 | 2.0E-51 |
sp|A9IRN9|PANC_BART1 | Pantothenate synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=panC PE=3 SV=1 | 23 | 304 | 2.0E-51 |
sp|Q5NL15|PANC_ZYMMO | Pantothenate synthetase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=panC PE=3 SV=2 | 25 | 280 | 2.0E-51 |
sp|Q743Y5|PANC_MYCPA | Pantothenate synthetase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=panC PE=3 SV=1 | 44 | 244 | 2.0E-51 |
sp|A9MPM2|PANC_SALAR | Pantothenate synthetase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=panC PE=3 SV=1 | 25 | 293 | 2.0E-51 |
sp|Q8FL31|PANC_ECOL6 | Pantothenate synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=panC PE=3 SV=2 | 25 | 321 | 2.0E-51 |
sp|Q0TLJ9|PANC_ECOL5 | Pantothenate synthetase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=panC PE=3 SV=1 | 25 | 293 | 3.0E-51 |
sp|B7MNZ5|PANC_ECO81 | Pantothenate synthetase OS=Escherichia coli O81 (strain ED1a) GN=panC PE=3 SV=1 | 25 | 293 | 3.0E-51 |
sp|Q2JJ30|PANCY_SYNJB | Bifunctional pantoate ligase/cytidylate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=panC/cmk PE=3 SV=1 | 26 | 354 | 3.0E-51 |
sp|C0Q5P3|PANC_SALPC | Pantothenate synthetase OS=Salmonella paratyphi C (strain RKS4594) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|B5RHC0|PANC_SALG2 | Pantothenate synthetase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|B5R3E5|PANC_SALEP | Pantothenate synthetase OS=Salmonella enteritidis PT4 (strain P125109) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|B5FIX7|PANC_SALDC | Pantothenate synthetase OS=Salmonella dublin (strain CT_02021853) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|Q57T74|PANC_SALCH | Pantothenate synthetase OS=Salmonella choleraesuis (strain SC-B67) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|Q1RG57|PANC_ECOUT | Pantothenate synthetase OS=Escherichia coli (strain UTI89 / UPEC) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|A1A7H9|PANC_ECOK1 | Pantothenate synthetase OS=Escherichia coli O1:K1 / APEC GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|B7UII1|PANC_ECO27 | Pantothenate synthetase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|B7LW40|PANC_ESCF3 | Pantothenate synthetase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=panC PE=3 SV=1 | 25 | 293 | 3.0E-51 |
sp|B7NI93|PANC_ECO7I | Pantothenate synthetase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=panC PE=3 SV=1 | 25 | 293 | 3.0E-51 |
sp|B1LGT5|PANC_ECOSM | Pantothenate synthetase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=panC PE=3 SV=1 | 25 | 293 | 3.0E-51 |
sp|Q07XZ7|PANC_SHEFN | Pantothenate synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=panC PE=3 SV=1 | 18 | 311 | 3.0E-51 |
sp|B7MBB6|PANC_ECO45 | Pantothenate synthetase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-51 |
sp|Q15NV6|PANC_PSEA6 | Pantothenate synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=panC PE=3 SV=1 | 23 | 304 | 4.0E-51 |
sp|Q9RV66|PANC_DEIRA | Pantothenate synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=panC PE=3 SV=1 | 46 | 273 | 4.0E-51 |
sp|B4TK04|PANC_SALHS | Pantothenate synthetase OS=Salmonella heidelberg (strain SL476) GN=panC PE=3 SV=1 | 25 | 321 | 5.0E-51 |
sp|Q83SM0|PANC_SHIFL | Pantothenate synthetase OS=Shigella flexneri GN=panC PE=3 SV=1 | 25 | 297 | 5.0E-51 |
sp|Q0T868|PANC_SHIF8 | Pantothenate synthetase OS=Shigella flexneri serotype 5b (strain 8401) GN=panC PE=3 SV=1 | 25 | 297 | 5.0E-51 |
sp|Q6F855|PANC_ACIAD | Pantothenate synthetase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=panC PE=3 SV=1 | 28 | 258 | 5.0E-51 |
sp|A4VPM7|PANC_PSEU5 | Pantothenate synthetase OS=Pseudomonas stutzeri (strain A1501) GN=panC PE=3 SV=1 | 44 | 286 | 5.0E-51 |
sp|A5G3A1|PANC_GEOUR | Pantothenate synthetase OS=Geobacter uraniireducens (strain Rf4) GN=panC PE=3 SV=1 | 23 | 335 | 5.0E-51 |
sp|Q47W59|PANC_COLP3 | Pantothenate synthetase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=panC PE=3 SV=1 | 32 | 305 | 5.0E-51 |
sp|B6HZA8|PANC_ECOSE | Pantothenate synthetase OS=Escherichia coli (strain SE11) GN=panC PE=3 SV=1 | 25 | 297 | 6.0E-51 |
sp|P31663|PANC_ECOLI | Pantothenate synthetase OS=Escherichia coli (strain K12) GN=panC PE=1 SV=1 | 25 | 297 | 6.0E-51 |
sp|A7ZW82|PANC_ECOHS | Pantothenate synthetase OS=Escherichia coli O9:H4 (strain HS) GN=panC PE=3 SV=1 | 25 | 297 | 6.0E-51 |
sp|B1XCA8|PANC_ECODH | Pantothenate synthetase OS=Escherichia coli (strain K12 / DH10B) GN=panC PE=3 SV=1 | 25 | 297 | 6.0E-51 |
sp|C4ZRM6|PANC_ECOBW | Pantothenate synthetase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=panC PE=3 SV=1 | 25 | 297 | 6.0E-51 |
sp|B7M174|PANC_ECO8A | Pantothenate synthetase OS=Escherichia coli O8 (strain IAI1) GN=panC PE=3 SV=1 | 25 | 297 | 6.0E-51 |
sp|B7LGJ5|PANC_ECO55 | Pantothenate synthetase OS=Escherichia coli (strain 55989 / EAEC) GN=panC PE=3 SV=1 | 25 | 297 | 6.0E-51 |
sp|A7ZHM3|PANC_ECO24 | Pantothenate synthetase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=panC PE=3 SV=1 | 25 | 297 | 6.0E-51 |
sp|Q8FUA6|PANC_COREF | Pantothenate synthetase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=panC PE=3 SV=2 | 38 | 354 | 6.0E-51 |
sp|Q7NJM6|PANCY_GLOVI | Bifunctional pantoate ligase/cytidylate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=panC/cmk PE=3 SV=1 | 23 | 352 | 6.0E-51 |
sp|B5F832|PANC_SALA4 | Pantothenate synthetase OS=Salmonella agona (strain SL483) GN=panC PE=3 SV=1 | 25 | 321 | 6.0E-51 |
sp|B8FJ17|PANC_DESAA | Pantothenate synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=panC PE=3 SV=1 | 44 | 354 | 6.0E-51 |
sp|A3QHQ2|PANC_SHELP | Pantothenate synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=panC PE=3 SV=1 | 32 | 324 | 6.0E-51 |
sp|B2UW10|PANC_HELPS | Pantothenate synthetase OS=Helicobacter pylori (strain Shi470) GN=panC PE=3 SV=1 | 23 | 321 | 7.0E-51 |
sp|Q9KC86|PANC_BACHD | Pantothenate synthetase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=panC PE=3 SV=1 | 25 | 311 | 7.0E-51 |
sp|A8GIZ7|PANC_SERP5 | Pantothenate synthetase OS=Serratia proteamaculans (strain 568) GN=panC PE=3 SV=1 | 32 | 321 | 8.0E-51 |
sp|Q211R2|PANC_RHOPB | Pantothenate synthetase OS=Rhodopseudomonas palustris (strain BisB18) GN=panC PE=3 SV=2 | 20 | 304 | 8.0E-51 |
sp|B7N803|PANC_ECOLU | Pantothenate synthetase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=panC PE=3 SV=1 | 25 | 293 | 8.0E-51 |
sp|Q3MEJ8|PANCY_ANAVT | Bifunctional pantoate ligase/cytidylate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=panC/cmk PE=3 SV=1 | 29 | 310 | 1.0E-50 |
sp|Q110U9|PANCY_TRIEI | Bifunctional pantoate ligase/cytidylate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=panC/cmk PE=3 SV=1 | 32 | 352 | 1.0E-50 |
sp|Q7MAP3|PANC_WOLSU | Pantothenate synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=panC PE=3 SV=1 | 23 | 350 | 1.0E-50 |
sp|Q09673|PANC_SCHPO | Pantoate--beta-alanine ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan6 PE=3 SV=1 | 35 | 270 | 1.0E-50 |
sp|Q2NVR3|PANC_SODGM | Pantothenate synthetase OS=Sodalis glossinidius (strain morsitans) GN=panC PE=3 SV=1 | 25 | 321 | 1.0E-50 |
sp|A7MGP7|PANC_CROS8 | Pantothenate synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=panC PE=3 SV=1 | 25 | 261 | 1.0E-50 |
sp|A0QA93|PANC_MYCA1 | Pantothenate synthetase OS=Mycobacterium avium (strain 104) GN=panC PE=3 SV=1 | 44 | 244 | 2.0E-50 |
sp|A1JJN7|PANC_YERE8 | Pantothenate synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=panC PE=3 SV=1 | 32 | 321 | 2.0E-50 |
sp|Q0VSR4|PANC_ALCBS | Pantothenate synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=panC PE=3 SV=1 | 32 | 304 | 2.0E-50 |
sp|Q6G079|PANC_BARQU | Pantothenate synthetase OS=Bartonella quintana (strain Toulouse) GN=panC PE=3 SV=1 | 22 | 304 | 2.0E-50 |
sp|Q9ZN52|PANC_HELPJ | Pantothenate synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=panC PE=3 SV=1 | 23 | 321 | 2.0E-50 |
sp|B1IQK7|PANC_ECOLC | Pantothenate synthetase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=panC PE=3 SV=1 | 25 | 297 | 2.0E-50 |
sp|A5FVZ7|PANC_ACICJ | Pantothenate synthetase OS=Acidiphilium cryptum (strain JF-5) GN=panC PE=3 SV=1 | 23 | 259 | 2.0E-50 |
sp|B3E5L0|PANC_GEOLS | Pantothenate synthetase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=panC PE=3 SV=1 | 23 | 324 | 3.0E-50 |
sp|B2VD18|PANC_ERWT9 | Pantothenate synthetase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=panC PE=3 SV=1 | 32 | 321 | 3.0E-50 |
sp|B5BL64|PANC_SALPK | Pantothenate synthetase OS=Salmonella paratyphi A (strain AKU_12601) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-50 |
sp|Q5PDB8|PANC_SALPA | Pantothenate synthetase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=panC PE=3 SV=1 | 25 | 321 | 3.0E-50 |
sp|Q3JCP8|PANC_NITOC | Pantothenate synthetase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-50 |
sp|B1JK36|PANC_YERPY | Pantothenate synthetase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=panC PE=3 SV=1 | 32 | 321 | 3.0E-50 |
sp|Q66EG4|PANC_YERPS | Pantothenate synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=panC PE=3 SV=1 | 32 | 321 | 3.0E-50 |
sp|B2K533|PANC_YERPB | Pantothenate synthetase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=panC PE=3 SV=1 | 32 | 321 | 3.0E-50 |
sp|A7FM23|PANC_YERP3 | Pantothenate synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=panC PE=3 SV=1 | 32 | 321 | 3.0E-50 |
sp|Q6D1X5|PANC_PECAS | Pantothenate synthetase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=panC PE=3 SV=1 | 32 | 320 | 4.0E-50 |
sp|Q32JW8|PANC_SHIDS | Pantothenate synthetase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=panC PE=3 SV=1 | 25 | 297 | 4.0E-50 |
sp|Q2N659|PANC_ERYLH | Pantothenate synthetase OS=Erythrobacter litoralis (strain HTCC2594) GN=panC PE=3 SV=1 | 45 | 308 | 4.0E-50 |
sp|Q7N870|PANC_PHOLL | Pantothenate synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=panC PE=3 SV=1 | 16 | 299 | 5.0E-50 |
sp|Q8ZRR1|PANC_SALTY | Pantothenate synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=panC PE=1 SV=1 | 25 | 321 | 5.0E-50 |
sp|Q6G456|PANC_BARHE | Pantothenate synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=panC PE=3 SV=2 | 45 | 304 | 5.0E-50 |
sp|C3MEL7|PANC_RHISN | Pantothenate synthetase OS=Rhizobium sp. (strain NGR234) GN=panC PE=3 SV=1 | 23 | 263 | 5.0E-50 |
sp|C5B9K5|PANC_EDWI9 | Pantothenate synthetase OS=Edwardsiella ictaluri (strain 93-146) GN=panC PE=3 SV=1 | 32 | 302 | 6.0E-50 |
sp|A8ERB8|PANC_ARCB4 | Pantothenate synthetase OS=Arcobacter butzleri (strain RM4018) GN=panC PE=3 SV=1 | 23 | 321 | 7.0E-50 |
sp|Q16DW6|PANC_ROSDO | Pantothenate synthetase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=panC PE=3 SV=1 | 22 | 308 | 8.0E-50 |
sp|A6GVV3|PANC_FLAPJ | Pantothenate synthetase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=panC PE=3 SV=1 | 32 | 304 | 9.0E-50 |
sp|B9IVR2|PANC_BACCQ | Pantothenate synthetase OS=Bacillus cereus (strain Q1) GN=panC PE=3 SV=1 | 23 | 352 | 9.0E-50 |
sp|B7HL54|PANC_BACC7 | Pantothenate synthetase OS=Bacillus cereus (strain AH187) GN=panC PE=3 SV=1 | 23 | 352 | 9.0E-50 |
sp|A9ETA6|PANC_SORC5 | Pantothenate synthetase OS=Sorangium cellulosum (strain So ce56) GN=panC PE=3 SV=1 | 32 | 304 | 9.0E-50 |
sp|B0V5P7|PANC_ACIBY | Pantothenate synthetase OS=Acinetobacter baumannii (strain AYE) GN=panC PE=3 SV=1 | 44 | 259 | 1.0E-49 |
sp|A3M294|PANC_ACIBT | Pantothenate synthetase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=panC PE=3 SV=2 | 44 | 259 | 1.0E-49 |
sp|B0VKK3|PANC_ACIBS | Pantothenate synthetase OS=Acinetobacter baumannii (strain SDF) GN=panC PE=3 SV=1 | 44 | 259 | 1.0E-49 |
sp|B2HTG5|PANC_ACIBC | Pantothenate synthetase OS=Acinetobacter baumannii (strain ACICU) GN=panC PE=3 SV=1 | 44 | 259 | 1.0E-49 |
sp|B7I683|PANC_ACIB5 | Pantothenate synthetase OS=Acinetobacter baumannii (strain AB0057) GN=panC PE=3 SV=1 | 44 | 259 | 1.0E-49 |
sp|B7H010|PANC_ACIB3 | Pantothenate synthetase OS=Acinetobacter baumannii (strain AB307-0294) GN=panC PE=3 SV=1 | 44 | 259 | 1.0E-49 |
sp|Q1B2L8|PANC_MYCSS | Pantothenate synthetase OS=Mycobacterium sp. (strain MCS) GN=panC PE=3 SV=1 | 44 | 233 | 1.0E-49 |
sp|A1UMI0|PANC_MYCSK | Pantothenate synthetase OS=Mycobacterium sp. (strain KMS) GN=panC PE=3 SV=1 | 44 | 233 | 1.0E-49 |
sp|Q2S2P6|PANC_SALRD | Pantothenate synthetase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=panC PE=3 SV=1 | 23 | 322 | 2.0E-49 |
sp|B4SUA7|PANC_SALNS | Pantothenate synthetase OS=Salmonella newport (strain SL254) GN=panC PE=3 SV=1 | 25 | 321 | 2.0E-49 |
sp|A4TPV4|PANC_YERPP | Pantothenate synthetase OS=Yersinia pestis (strain Pestoides F) GN=panC PE=3 SV=1 | 32 | 321 | 2.0E-49 |
sp|Q1CLW1|PANC_YERPN | Pantothenate synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=panC PE=3 SV=1 | 32 | 321 | 2.0E-49 |
sp|A9R1G3|PANC_YERPG | Pantothenate synthetase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=panC PE=3 SV=1 | 32 | 321 | 2.0E-49 |
sp|Q8ZBK7|PANC_YERPE | Pantothenate synthetase OS=Yersinia pestis GN=panC PE=1 SV=1 | 32 | 321 | 2.0E-49 |
sp|Q1C3V7|PANC_YERPA | Pantothenate synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=panC PE=3 SV=1 | 32 | 321 | 2.0E-49 |
sp|B4TXN3|PANC_SALSV | Pantothenate synthetase OS=Salmonella schwarzengrund (strain CVM19633) GN=panC PE=3 SV=1 | 25 | 321 | 2.0E-49 |
sp|A9MZT0|PANC_SALPB | Pantothenate synthetase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=panC PE=3 SV=1 | 25 | 321 | 2.0E-49 |
sp|A4XCQ4|PANC_SALTO | Pantothenate synthetase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=panC PE=3 SV=1 | 45 | 244 | 2.0E-49 |
sp|Q9X713|PANC_CORGL | Pantothenate synthetase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=panC PE=1 SV=1 | 41 | 352 | 2.0E-49 |
sp|Q8Z9D3|PANC_SALTI | Pantothenate synthetase OS=Salmonella typhi GN=panC PE=3 SV=1 | 25 | 321 | 2.0E-49 |
sp|Q30TN9|PANC_SULDN | Pantothenate synthetase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=panC PE=3 SV=1 | 32 | 272 | 2.0E-49 |
sp|Q2VZ00|PANC_MAGSA | Pantothenate synthetase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=panC PE=3 SV=1 | 20 | 354 | 3.0E-49 |
sp|A7I0P8|PANC_CAMHC | Pantothenate synthetase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=panC PE=3 SV=1 | 23 | 321 | 3.0E-49 |
sp|A0RQM8|PANC_CAMFF | Pantothenate synthetase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=panC PE=3 SV=1 | 23 | 321 | 3.0E-49 |
sp|A3Q6Y5|PANC_MYCSJ | Pantothenate synthetase OS=Mycobacterium sp. (strain JLS) GN=panC PE=3 SV=1 | 44 | 233 | 3.0E-49 |
sp|A1TG35|PANC_MYCVP | Pantothenate synthetase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=panC PE=3 SV=1 | 44 | 233 | 5.0E-49 |
sp|A0R580|PANC_MYCS2 | Pantothenate synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=panC PE=1 SV=1 | 44 | 238 | 5.0E-49 |
sp|A5EKW3|PANC_BRASB | Pantothenate synthetase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=panC PE=3 SV=1 | 20 | 304 | 6.0E-49 |
sp|C4L6Q1|PANC_EXISA | Pantothenate synthetase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=panC PE=3 SV=1 | 23 | 351 | 9.0E-49 |
sp|A4QAA5|PANC_CORGB | Pantothenate synthetase OS=Corynebacterium glutamicum (strain R) GN=panC PE=3 SV=1 | 41 | 352 | 1.0E-48 |
sp|A6SWZ8|PANC_JANMA | Pantothenate synthetase OS=Janthinobacterium sp. (strain Marseille) GN=panC PE=3 SV=1 | 23 | 324 | 1.0E-48 |
sp|B5Y1P6|PANC_KLEP3 | Pantothenate synthetase OS=Klebsiella pneumoniae (strain 342) GN=panC PE=3 SV=1 | 25 | 321 | 1.0E-48 |
sp|Q9A6C8|PANC_CAUCR | Pantothenate synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=panC PE=3 SV=1 | 21 | 244 | 1.0E-48 |
sp|A6L8I6|PANC_PARD8 | Pantothenate synthetase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=panC PE=3 SV=1 | 23 | 251 | 2.0E-48 |
sp|Q135F0|PANC_RHOPS | Pantothenate synthetase OS=Rhodopseudomonas palustris (strain BisB5) GN=panC PE=3 SV=1 | 45 | 304 | 2.0E-48 |
sp|A6T4S9|PANC_KLEP7 | Pantothenate synthetase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=panC PE=3 SV=1 | 25 | 321 | 2.0E-48 |
sp|Q73AV3|PANC_BACC1 | Pantothenate synthetase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-48 |
sp|Q63DJ2|PANC_BACCZ | Pantothenate synthetase OS=Bacillus cereus (strain ZK / E33L) GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-48 |
sp|A8FEH6|PANC_BACP2 | Pantothenate synthetase OS=Bacillus pumilus (strain SAFR-032) GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-48 |
sp|Q81ST2|PANC_BACAN | Pantothenate synthetase OS=Bacillus anthracis GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-48 |
sp|C3L8P9|PANC_BACAC | Pantothenate synthetase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-48 |
sp|C3P5R0|PANC_BACAA | Pantothenate synthetase OS=Bacillus anthracis (strain A0248) GN=panC PE=3 SV=1 | 23 | 352 | 2.0E-48 |
sp|Q0ANX4|PANC_MARMM | Pantothenate synthetase OS=Maricaulis maris (strain MCS10) GN=panC PE=3 SV=1 | 16 | 258 | 2.0E-48 |
sp|Q6ALV3|PANC_DESPS | Pantothenate synthetase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=panC PE=3 SV=1 | 45 | 324 | 2.0E-48 |
sp|Q5KXX3|PANC_GEOKA | Pantothenate synthetase OS=Geobacillus kaustophilus (strain HTA426) GN=panC PE=3 SV=1 | 32 | 353 | 3.0E-48 |
sp|Q0AB68|PANC_ALKEH | Pantothenate synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=panC PE=3 SV=1 | 35 | 304 | 3.0E-48 |
sp|C1D7E9|PANC_LARHH | Pantothenate synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=panC PE=3 SV=1 | 25 | 305 | 3.0E-48 |
sp|Q605G9|PANC_METCA | Pantothenate synthetase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=panC PE=3 SV=1 | 45 | 298 | 4.0E-48 |
sp|C6C1U6|PANC_DESAD | Pantothenate synthetase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=panC PE=3 SV=1 | 44 | 353 | 4.0E-48 |
sp|B9L5Y8|PANC_NAUPA | Pantothenate synthetase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=panC PE=3 SV=1 | 45 | 321 | 5.0E-48 |
sp|Q11F81|PANC_CHESB | Pantothenate synthetase OS=Chelativorans sp. (strain BNC1) GN=panC PE=3 SV=1 | 22 | 314 | 5.0E-48 |
sp|Q6HL15|PANC_BACHK | Pantothenate synthetase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=panC PE=3 SV=1 | 23 | 352 | 5.0E-48 |
sp|B7JHQ7|PANC_BACC0 | Pantothenate synthetase OS=Bacillus cereus (strain AH820) GN=panC PE=3 SV=1 | 23 | 352 | 5.0E-48 |
sp|Q4A0T9|PANC_STAS1 | Pantothenate synthetase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=panC PE=3 SV=1 | 24 | 271 | 5.0E-48 |
sp|Q6N528|PANC_RHOPA | Pantothenate synthetase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=panC PE=3 SV=1 | 45 | 285 | 5.0E-48 |
sp|Q6MHI2|PANC_BDEBA | Pantothenate synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=panC PE=3 SV=1 | 24 | 253 | 6.0E-48 |
sp|Q89JV7|PANC2_BRADU | Pantothenate synthetase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=panC2 PE=3 SV=1 | 20 | 265 | 6.0E-48 |
sp|Q0RC35|PANC3_FRAAA | Pantothenate synthetase 3 OS=Frankia alni (strain ACN14a) GN=panC3 PE=3 SV=1 | 23 | 249 | 6.0E-48 |
sp|A1WUU4|PANC_HALHL | Pantothenate synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=panC PE=3 SV=1 | 23 | 306 | 7.0E-48 |
sp|B8J4Q1|PANC_DESDA | Pantothenate synthetase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=panC PE=3 SV=1 | 46 | 352 | 1.0E-47 |
sp|B5ES06|PANC_ACIF5 | Pantothenate synthetase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=panC PE=3 SV=1 | 25 | 352 | 1.0E-47 |
sp|B7JBM7|PANC_ACIF2 | Pantothenate synthetase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=panC PE=3 SV=1 | 25 | 352 | 1.0E-47 |
sp|A4IQ60|PANC_GEOTN | Pantothenate synthetase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=panC PE=3 SV=1 | 25 | 353 | 1.0E-47 |
sp|A8M8F3|PANC_SALAI | Pantothenate synthetase OS=Salinispora arenicola (strain CNS-205) GN=panC PE=3 SV=1 | 45 | 244 | 1.0E-47 |
sp|A4G3S0|PANC_HERAR | Pantothenate synthetase OS=Herminiimonas arsenicoxydans GN=panC PE=3 SV=1 | 23 | 324 | 1.0E-47 |
sp|Q0C347|PANC_HYPNA | Pantothenate synthetase OS=Hyphomonas neptunium (strain ATCC 15444) GN=panC PE=3 SV=1 | 23 | 307 | 1.0E-47 |
sp|B7IPB8|PANC_BACC2 | Pantothenate synthetase OS=Bacillus cereus (strain G9842) GN=panC PE=3 SV=1 | 23 | 261 | 1.0E-47 |
sp|Q0BU46|PANC_GRABC | Pantothenate synthetase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=panC PE=3 SV=1 | 44 | 310 | 2.0E-47 |
sp|A5GVR3|PANCY_SYNR3 | Bifunctional pantoate ligase/cytidylate kinase OS=Synechococcus sp. (strain RCC307) GN=panC/cmk PE=3 SV=1 | 48 | 323 | 2.0E-47 |
sp|Q1QEJ3|PANC_PSYCK | Pantothenate synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=panC PE=3 SV=1 | 29 | 271 | 3.0E-47 |
sp|Q1H3S1|PANC_METFK | Pantothenate synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=panC PE=3 SV=1 | 22 | 261 | 3.0E-47 |
sp|A0AK06|PANC_LISW6 | Pantothenate synthetase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=panC PE=3 SV=1 | 25 | 323 | 3.0E-47 |
sp|Q2IXG7|PANC_RHOP2 | Pantothenate synthetase OS=Rhodopseudomonas palustris (strain HaA2) GN=panC PE=3 SV=1 | 45 | 259 | 3.0E-47 |
sp|A1R163|PANC_ARTAT | Pantothenate synthetase OS=Arthrobacter aurescens (strain TC1) GN=panC PE=3 SV=2 | 45 | 349 | 3.0E-47 |
sp|A4SG25|PANC_CHLPM | Pantothenate synthetase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=panC PE=3 SV=1 | 41 | 349 | 3.0E-47 |
sp|B4EUD2|PANC_PROMH | Pantothenate synthetase OS=Proteus mirabilis (strain HI4320) GN=panC PE=3 SV=1 | 44 | 269 | 3.0E-47 |
sp|Q4FVG7|PANC_PSYA2 | Pantothenate synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=panC PE=3 SV=1 | 46 | 271 | 4.0E-47 |
sp|C1EN37|PANC_BACC3 | Pantothenate synthetase OS=Bacillus cereus (strain 03BB102) GN=panC PE=3 SV=1 | 23 | 352 | 4.0E-47 |
sp|A0RBZ3|PANC_BACAH | Pantothenate synthetase OS=Bacillus thuringiensis (strain Al Hakam) GN=panC PE=3 SV=2 | 23 | 352 | 4.0E-47 |
sp|Q1LJM9|PANC_CUPMC | Pantothenate synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=panC PE=3 SV=1 | 23 | 305 | 4.0E-47 |
sp|Q6NEB8|PANC_CORDI | Pantothenate synthetase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=panC PE=3 SV=1 | 25 | 261 | 4.0E-47 |
sp|A7ZE20|PANC_CAMC1 | Pantothenate synthetase OS=Campylobacter concisus (strain 13826) GN=panC PE=3 SV=1 | 23 | 321 | 5.0E-47 |
sp|B7HHU4|PANC_BACC4 | Pantothenate synthetase OS=Bacillus cereus (strain B4264) GN=panC PE=3 SV=1 | 23 | 352 | 5.0E-47 |
sp|Q92AA7|PANC_LISIN | Pantothenate synthetase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=panC PE=3 SV=1 | 25 | 323 | 5.0E-47 |
sp|C5CWV0|PANC_VARPS | Pantothenate synthetase OS=Variovorax paradoxus (strain S110) GN=panC PE=3 SV=1 | 23 | 305 | 5.0E-47 |
sp|B1HU20|PANC_LYSSC | Pantothenate synthetase OS=Lysinibacillus sphaericus (strain C3-41) GN=panC PE=3 SV=1 | 23 | 257 | 6.0E-47 |
sp|Q89ZR8|PANC_BACTN | Pantothenate synthetase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=panC PE=3 SV=1 | 44 | 307 | 6.0E-47 |
sp|Q3SRX8|PANC_NITWN | Pantothenate synthetase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=panC PE=3 SV=1 | 45 | 260 | 6.0E-47 |
sp|Q11NE6|PANC_CYTH3 | Pantothenate synthetase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=panC PE=3 SV=1 | 26 | 352 | 7.0E-47 |
sp|B2SFS8|PANC_FRATM | Pantothenate synthetase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=panC PE=3 SV=1 | 37 | 249 | 8.0E-47 |
sp|A4IWW5|PANC_FRATW | Pantothenate synthetase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=panC PE=3 SV=1 | 37 | 249 | 9.0E-47 |
sp|Q5NF57|PANC_FRATT | Pantothenate synthetase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=panC PE=1 SV=1 | 37 | 249 | 9.0E-47 |
sp|Q14GL0|PANC_FRAT1 | Pantothenate synthetase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=panC PE=3 SV=1 | 37 | 249 | 9.0E-47 |
sp|Q2G319|PANC_NOVAD | Pantothenate synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=panC PE=3 SV=1 | 44 | 307 | 9.0E-47 |
sp|Q81FN6|PANC_BACCR | Pantothenate synthetase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=panC PE=3 SV=1 | 23 | 352 | 1.0E-46 |
sp|A6Q581|PANC_NITSB | Pantothenate synthetase OS=Nitratiruptor sp. (strain SB155-2) GN=panC PE=3 SV=1 | 45 | 352 | 1.0E-46 |
sp|B9KLD3|PANC_RHOSK | Pantothenate synthetase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=panC PE=3 SV=1 | 25 | 259 | 1.0E-46 |
sp|Q0BMQ6|PANC_FRATO | Pantothenate synthetase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=panC PE=3 SV=2 | 37 | 249 | 1.0E-46 |
sp|Q2A4C7|PANC_FRATH | Pantothenate synthetase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=panC PE=3 SV=1 | 37 | 249 | 1.0E-46 |
sp|A7NB31|PANC_FRATF | Pantothenate synthetase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=panC PE=3 SV=1 | 37 | 249 | 1.0E-46 |
sp|Q8Y602|PANC_LISMO | Pantothenate synthetase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=panC PE=3 SV=1 | 25 | 323 | 2.0E-46 |
sp|Q2YAP0|PANC_NITMU | Pantothenate synthetase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=panC PE=3 SV=1 | 37 | 287 | 2.0E-46 |
sp|A3PGQ3|PANC_RHOS1 | Pantothenate synthetase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=panC PE=3 SV=1 | 25 | 259 | 2.0E-46 |
sp|Q1QKN4|PANC_NITHX | Pantothenate synthetase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=panC PE=3 SV=1 | 45 | 258 | 3.0E-46 |
sp|B2RKW6|PANC_PORG3 | Pantothenate synthetase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=panC PE=3 SV=1 | 23 | 308 | 3.0E-46 |
sp|A7GZE9|PANC_CAMC5 | Pantothenate synthetase OS=Campylobacter curvus (strain 525.92) GN=panC PE=3 SV=1 | 46 | 302 | 3.0E-46 |
sp|A0Q7L3|PANC_FRATN | Pantothenate synthetase OS=Francisella tularensis subsp. novicida (strain U112) GN=panC PE=3 SV=1 | 37 | 249 | 3.0E-46 |
sp|B3QM10|PANC_CHLP8 | Pantothenate synthetase OS=Chlorobaculum parvum (strain NCIB 8327) GN=panC PE=3 SV=1 | 41 | 261 | 3.0E-46 |
sp|B4S5G6|PANC_PROA2 | Pantothenate synthetase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=panC PE=3 SV=1 | 41 | 322 | 4.0E-46 |
sp|P52998|PANC_BACSU | Pantothenate synthetase OS=Bacillus subtilis (strain 168) GN=panC PE=3 SV=1 | 44 | 274 | 4.0E-46 |
sp|C1KWK1|PANC_LISMC | Pantothenate synthetase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=panC PE=3 SV=1 | 25 | 323 | 5.0E-46 |
sp|Q7NXJ0|PANC_CHRVO | Pantothenate synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=panC PE=3 SV=1 | 23 | 305 | 5.0E-46 |
sp|P57036|PANC_NEIMB | Pantothenate synthetase OS=Neisseria meningitidis serogroup B (strain MC58) GN=panC PE=3 SV=1 | 23 | 265 | 5.0E-46 |
sp|Q0S8D5|PANC_RHOJR | Pantothenate synthetase OS=Rhodococcus jostii (strain RHA1) GN=panC PE=3 SV=1 | 44 | 238 | 6.0E-46 |
sp|Q5LGS1|PANC_BACFN | Pantothenate synthetase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=panC PE=3 SV=1 | 44 | 308 | 6.0E-46 |
sp|Q82Y17|PANC_NITEU | Pantothenate synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=panC PE=3 SV=1 | 45 | 266 | 6.0E-46 |
sp|Q5WGA4|PANC_BACSK | Pantothenate synthetase OS=Bacillus clausii (strain KSM-K16) GN=panC PE=3 SV=1 | 44 | 251 | 7.0E-46 |
sp|A4W6N7|PANC_ENT38 | Pantothenate synthetase OS=Enterobacter sp. (strain 638) GN=panC PE=3 SV=1 | 25 | 297 | 7.0E-46 |
sp|A1AW71|PANC_RUTMC | Pantothenate synthetase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=panC PE=3 SV=1 | 44 | 354 | 7.0E-46 |
sp|B8D7A0|PANC_BUCAT | Pantothenate synthetase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=panC PE=3 SV=1 | 23 | 251 | 9.0E-46 |
sp|B3R684|PANC_CUPTR | Pantothenate synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=panC PE=3 SV=1 | 23 | 305 | 1.0E-45 |
sp|Q050C4|PANC_LEPBL | Pantothenate synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=panC PE=3 SV=1 | 25 | 321 | 1.0E-45 |
sp|Q04S98|PANC_LEPBJ | Pantothenate synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=panC PE=3 SV=1 | 25 | 321 | 1.0E-45 |
sp|P57292|PANC_BUCAI | Pantothenate synthetase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=panC PE=3 SV=1 | 23 | 251 | 1.0E-45 |
sp|B8D8Z5|PANC_BUCA5 | Pantothenate synthetase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=panC PE=3 SV=1 | 23 | 251 | 1.0E-45 |
sp|Q9X844|PANC_STRCO | Pantothenate synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=panC PE=3 SV=2 | 51 | 250 | 1.0E-45 |
sp|A4F6T0|PANC_SACEN | Pantothenate synthetase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=panC PE=3 SV=1 | 44 | 302 | 1.0E-45 |
sp|B1YHQ8|PANC_EXIS2 | Pantothenate synthetase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=panC PE=3 SV=1 | 23 | 238 | 1.0E-45 |
sp|B0TXZ9|PANC_FRAP2 | Pantothenate synthetase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=panC PE=3 SV=1 | 25 | 230 | 1.0E-45 |
sp|Q71YB4|PANC_LISMF | Pantothenate synthetase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=panC PE=3 SV=1 | 25 | 323 | 1.0E-45 |
sp|B8DSC4|PANC_DESVM | Pantothenate synthetase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=panC PE=3 SV=1 | 48 | 317 | 1.0E-45 |
sp|Q21U08|PANC_RHOFT | Pantothenate synthetase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=panC PE=3 SV=1 | 23 | 265 | 1.0E-45 |
sp|Q21LV6|PANC_SACD2 | Pantothenate synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=panC PE=3 SV=1 | 44 | 305 | 2.0E-45 |
sp|B8DC25|PANC_LISMH | Pantothenate synthetase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=panC PE=3 SV=1 | 25 | 323 | 2.0E-45 |
sp|A6W2I4|PANC_MARMS | Pantothenate synthetase OS=Marinomonas sp. (strain MWYL1) GN=panC PE=3 SV=1 | 23 | 305 | 2.0E-45 |
sp|Q64XM3|PANC_BACFR | Pantothenate synthetase OS=Bacteroides fragilis (strain YCH46) GN=panC PE=3 SV=1 | 44 | 308 | 2.0E-45 |
sp|Q311U9|PANC_DESAG | Pantothenate synthetase OS=Desulfovibrio alaskensis (strain G20) GN=panC PE=3 SV=1 | 45 | 324 | 2.0E-45 |
sp|A1B2L1|PANC_PARDP | Pantothenate synthetase OS=Paracoccus denitrificans (strain Pd 1222) GN=panC PE=3 SV=1 | 25 | 314 | 2.0E-45 |
sp|Q8KBY5|PANC_CHLTE | Pantothenate synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=panC PE=3 SV=1 | 41 | 274 | 3.0E-45 |
sp|Q5F9F8|PANC_NEIG1 | Pantothenate synthetase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=panC PE=3 SV=1 | 23 | 271 | 3.0E-45 |
sp|Q143J2|PANC_BURXL | Pantothenate synthetase OS=Burkholderia xenovorans (strain LB400) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-45 |
sp|B2JEQ7|PANC_BURP8 | Pantothenate synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=panC PE=3 SV=1 | 23 | 308 | 4.0E-45 |
sp|P57035|PANC_NEIMA | Pantothenate synthetase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=panC PE=3 SV=1 | 23 | 265 | 4.0E-45 |
sp|A0JR91|PANC_ARTS2 | Pantothenate synthetase OS=Arthrobacter sp. (strain FB24) GN=panC PE=3 SV=1 | 45 | 307 | 5.0E-45 |
sp|Q98ND0|PANC_RHILO | Pantothenate synthetase OS=Rhizobium loti (strain MAFF303099) GN=panC PE=3 SV=1 | 25 | 260 | 5.0E-45 |
sp|A9VMF0|PANC_BACWK | Pantothenate synthetase OS=Bacillus weihenstephanensis (strain KBAB4) GN=panC PE=3 SV=1 | 23 | 261 | 5.0E-45 |
sp|A1KTB2|PANC_NEIMF | Pantothenate synthetase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=panC PE=3 SV=1 | 23 | 265 | 7.0E-45 |
sp|A2SEX7|PANC_METPP | Pantothenate synthetase OS=Methylibium petroleiphilum (strain PM1) GN=panC PE=3 SV=1 | 23 | 305 | 8.0E-45 |
sp|Q474Y3|PANC_CUPPJ | Pantothenate synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=panC PE=3 SV=1 | 23 | 305 | 1.0E-44 |
sp|O69524|PANC_MYCLE | Pantothenate synthetase OS=Mycobacterium leprae (strain TN) GN=panC PE=3 SV=2 | 44 | 238 | 1.0E-44 |
sp|B2T172|PANC_BURPP | Pantothenate synthetase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=panC PE=3 SV=1 | 23 | 263 | 1.0E-44 |
sp|Q3J5N0|PANC_RHOS4 | Pantothenate synthetase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=panC PE=3 SV=1 | 25 | 259 | 1.0E-44 |
sp|Q2RP31|PANC_RHORT | Pantothenate synthetase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=panC PE=3 SV=2 | 22 | 321 | 1.0E-44 |
sp|B1GZJ9|PANC_UNCTG | Pantothenate synthetase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=panC PE=3 SV=1 | 23 | 322 | 1.0E-44 |
sp|Q8F394|PANC_LEPIN | Pantothenate synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=panC PE=3 SV=1 | 29 | 352 | 1.0E-44 |
sp|C5BN51|PANC_TERTT | Pantothenate synthetase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=panC PE=3 SV=1 | 23 | 304 | 1.0E-44 |
sp|B1Y4K7|PANC_LEPCP | Pantothenate synthetase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=panC PE=3 SV=1 | 23 | 286 | 1.0E-44 |
sp|Q0K7I6|PANC_CUPNH | Pantothenate synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=panC PE=3 SV=1 | 23 | 305 | 2.0E-44 |
sp|Q82EC8|PANC_STRAW | Pantothenate synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=panC PE=3 SV=1 | 25 | 257 | 2.0E-44 |
sp|B4SDX5|PANC_PELPB | Pantothenate synthetase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=panC PE=3 SV=1 | 23 | 314 | 2.0E-44 |
sp|O24210|PANC_ORYSJ | Pantoate--beta-alanine ligase OS=Oryza sativa subsp. japonica GN=PANC PE=2 SV=2 | 25 | 265 | 3.0E-44 |
sp|Q7MWV8|PANC_PORGI | Pantothenate synthetase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=panC PE=3 SV=1 | 44 | 308 | 4.0E-44 |
sp|Q3B2E3|PANC_CHLL7 | Pantothenate synthetase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=panC PE=3 SV=1 | 46 | 310 | 4.0E-44 |
sp|B3PCR5|PANC_CELJU | Pantothenate synthetase OS=Cellvibrio japonicus (strain Ueda107) GN=panC PE=3 SV=1 | 44 | 305 | 5.0E-44 |
sp|A1SSG8|PANC_PSYIN | Pantothenate synthetase OS=Psychromonas ingrahamii (strain 37) GN=panC PE=3 SV=1 | 32 | 308 | 6.0E-44 |
sp|Q65I57|PANC_BACLD | Pantothenate synthetase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=panC PE=3 SV=1 | 40 | 353 | 6.0E-44 |
sp|Q4JXL9|PANC_CORJK | Pantothenate synthetase OS=Corynebacterium jeikeium (strain K411) GN=panC PE=3 SV=1 | 24 | 302 | 7.0E-44 |
sp|B4SRY4|PANC_STRM5 | Pantothenate synthetase OS=Stenotrophomonas maltophilia (strain R551-3) GN=panC PE=3 SV=1 | 35 | 262 | 9.0E-44 |
sp|Q3SH82|PANC_THIDA | Pantothenate synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=panC PE=3 SV=1 | 48 | 258 | 9.0E-44 |
sp|A0M787|PANC_GRAFK | Pantothenate synthetase OS=Gramella forsetii (strain KT0803) GN=panC PE=3 SV=1 | 32 | 255 | 1.0E-43 |
sp|A1KAA6|PANC_AZOSB | Pantothenate synthetase OS=Azoarcus sp. (strain BH72) GN=panC PE=3 SV=1 | 49 | 261 | 1.0E-43 |
sp|A0LRC5|PANC_ACIC1 | Pantothenate synthetase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=panC PE=3 SV=1 | 25 | 233 | 1.0E-43 |
sp|B2FL68|PANC_STRMK | Pantothenate synthetase OS=Stenotrophomonas maltophilia (strain K279a) GN=panC PE=3 SV=1 | 35 | 259 | 1.0E-43 |
sp|B4E8E5|PANC_BURCJ | Pantothenate synthetase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=panC PE=3 SV=1 | 23 | 270 | 1.0E-43 |
sp|Q72SD0|PANC_LEPIC | Pantothenate synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=panC PE=3 SV=1 | 29 | 352 | 1.0E-43 |
sp|A7Z5Z3|PANC_BACMF | Pantothenate synthetase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=panC PE=3 SV=1 | 44 | 275 | 2.0E-43 |
sp|A5WHC9|PANC_PSYWF | Pantothenate synthetase OS=Psychrobacter sp. (strain PRwf-1) GN=panC PE=3 SV=1 | 44 | 302 | 2.0E-43 |
sp|A7GN77|PANC_BACCN | Pantothenate synthetase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=panC PE=3 SV=1 | 23 | 259 | 2.0E-43 |
sp|A6Q719|PANC_SULNB | Pantothenate synthetase OS=Sulfurovum sp. (strain NBC37-1) GN=panC PE=3 SV=1 | 45 | 350 | 3.0E-43 |
sp|Q6ACQ8|PANC_LEIXX | Pantothenate synthetase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=panC PE=3 SV=1 | 46 | 248 | 3.0E-43 |
sp|A9I1G8|PANC_BORPD | Pantothenate synthetase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=panC PE=3 SV=1 | 23 | 261 | 4.0E-43 |
sp|B2UA33|PANC_RALPJ | Pantothenate synthetase OS=Ralstonia pickettii (strain 12J) GN=panC PE=3 SV=1 | 23 | 248 | 4.0E-43 |
sp|Q8XWT3|PANC_RALSO | Pantothenate synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=panC PE=3 SV=1 | 23 | 248 | 6.0E-43 |
sp|B3EH07|PANC_CHLL2 | Pantothenate synthetase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=panC PE=3 SV=1 | 41 | 313 | 8.0E-43 |
sp|A6L4C3|PANC_BACV8 | Pantothenate synthetase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=panC PE=3 SV=1 | 44 | 350 | 8.0E-43 |
sp|Q39DU9|PANC_BURL3 | Pantothenate synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=panC PE=3 SV=1 | 23 | 265 | 1.0E-42 |
sp|B1JWS8|PANC_BURCC | Pantothenate synthetase OS=Burkholderia cenocepacia (strain MC0-3) GN=panC PE=3 SV=1 | 23 | 270 | 1.0E-42 |
sp|A1VKS2|PANC_POLNA | Pantothenate synthetase OS=Polaromonas naphthalenivorans (strain CJ2) GN=panC PE=3 SV=1 | 37 | 311 | 1.0E-42 |
sp|A0K9L5|PANC_BURCH | Pantothenate synthetase OS=Burkholderia cenocepacia (strain HI2424) GN=panC PE=3 SV=1 | 23 | 270 | 2.0E-42 |
sp|Q1BUH1|PANC_BURCA | Pantothenate synthetase OS=Burkholderia cenocepacia (strain AU 1054) GN=panC PE=3 SV=1 | 23 | 270 | 2.0E-42 |
sp|Q5LWR2|PANC_RUEPO | Pantothenate synthetase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=panC PE=3 SV=1 | 22 | 308 | 3.0E-42 |
sp|Q63W97|PANC_BURPS | Pantothenate synthetase OS=Burkholderia pseudomallei (strain K96243) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|A3N6X2|PANC_BURP6 | Pantothenate synthetase OS=Burkholderia pseudomallei (strain 668) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|Q3JUY8|PANC_BURP1 | Pantothenate synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|A3NSK8|PANC_BURP0 | Pantothenate synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|A1V5W8|PANC_BURMS | Pantothenate synthetase OS=Burkholderia mallei (strain SAVP1) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|Q62LE7|PANC_BURMA | Pantothenate synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|A2SAF0|PANC_BURM9 | Pantothenate synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|A3MLN2|PANC_BURM7 | Pantothenate synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-42 |
sp|Q2T095|PANC_BURTA | Pantothenate synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=panC PE=1 SV=1 | 23 | 304 | 4.0E-42 |
sp|A9AHJ3|PANC_BURM1 | Pantothenate synthetase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=panC PE=3 SV=1 | 23 | 265 | 5.0E-42 |
sp|Q47B65|PANC_DECAR | Pantothenate synthetase OS=Dechloromonas aromatica (strain RCB) GN=panC PE=3 SV=1 | 42 | 265 | 5.0E-42 |
sp|A4SWJ8|PANC_POLSQ | Pantothenate synthetase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=panC PE=3 SV=1 | 23 | 266 | 5.0E-42 |
sp|Q5NXQ2|PANC_AROAE | Pantothenate synthetase OS=Aromatoleum aromaticum (strain EbN1) GN=panC PE=3 SV=1 | 45 | 261 | 6.0E-42 |
sp|B3EMN7|PANC_CHLPB | Pantothenate synthetase OS=Chlorobium phaeobacteroides (strain BS1) GN=panC PE=3 SV=1 | 23 | 324 | 6.0E-42 |
sp|A1VBJ2|PANC_DESVV | Pantothenate synthetase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=panC PE=3 SV=1 | 32 | 352 | 8.0E-42 |
sp|Q729A4|PANC_DESVH | Pantothenate synthetase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=panC PE=3 SV=1 | 32 | 352 | 8.0E-42 |
sp|Q3APW7|PANC_CHLCH | Pantothenate synthetase OS=Chlorobium chlorochromatii (strain CaD3) GN=panC PE=3 SV=1 | 23 | 352 | 1.0E-41 |
sp|Q0ADS3|PANC_NITEC | Pantothenate synthetase OS=Nitrosomonas eutropha (strain C91) GN=panC PE=3 SV=1 | 23 | 261 | 1.0E-41 |
sp|A1BDY2|PANC_CHLPD | Pantothenate synthetase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=panC PE=3 SV=1 | 41 | 252 | 2.0E-41 |
sp|B1XVH8|PANC_POLNS | Pantothenate synthetase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=panC PE=3 SV=1 | 23 | 249 | 3.0E-41 |
sp|A4JGX1|PANC_BURVG | Pantothenate synthetase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=panC PE=3 SV=1 | 23 | 265 | 3.0E-41 |
GO Term | Description | Terminal node |
---|---|---|
GO:0015940 | pantothenate biosynthetic process | Yes |
GO:0004592 | pantoate-beta-alanine ligase activity | Yes |
GO:0043436 | oxoacid metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0006766 | vitamin metabolic process | No |
GO:0008150 | biological_process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0016881 | acid-amino acid ligase activity | No |
GO:0044281 | small molecule metabolic process | No |
GO:0009110 | vitamin biosynthetic process | No |
GO:0046394 | carboxylic acid biosynthetic process | No |
GO:0015939 | pantothenate metabolic process | No |
GO:0006082 | organic acid metabolic process | No |
GO:0019752 | carboxylic acid metabolic process | No |
GO:0044283 | small molecule biosynthetic process | No |
GO:0016053 | organic acid biosynthetic process | No |
GO:0006767 | water-soluble vitamin metabolic process | No |
GO:0032787 | monocarboxylic acid metabolic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0003824 | catalytic activity | No |
GO:0044237 | cellular metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0042398 | cellular modified amino acid biosynthetic process | No |
GO:0072330 | monocarboxylic acid biosynthetic process | No |
GO:0006575 | cellular modified amino acid metabolic process | No |
GO:0003674 | molecular_function | No |
GO:0042364 | water-soluble vitamin biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0043604 | amide biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0009987 | cellular process | No |
GO:0016874 | ligase activity | No |
GO:0043603 | cellular amide metabolic process | No |
GO:0016879 | ligase activity, forming carbon-nitrogen bonds | No |
GO:1901576 | organic substance biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 32 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauG2|3032 MASTTATWRGLQTKGETIPSTSIRIIRSVDAMRVWRRPQTLNHRSVGLVPTMGALHQGHLALVREAARQNHEVVV SLFVNPAQFGANEDLSSYPVTWDTDVQALARLDHELAQDGANLGRLAVVFAPSADVMYPSGIHGQHVDSKGSFVT ITPLAEQLEGASRPTFFRGVATVCMKLFNIVQPDRVYFGQKDVQQTVIIRRMVRDFMLPTQVVVCPTQRDADGLA LSSRNVYLGPRRRCVALALGRALRAAEAAYRAGQHDAAPLLAAAHDVCRDVLRAQAALAPDQRALFEIDYISLAD VDNLQELDVVDPAKGAVMSAAIKMPPLEKVQPGEDVGHAGGPQVRLLDNIILEPL* |
Coding | >OphauG2|3032 ATGGCCTCTACCACGGCTACATGGCGCGGGCTGCAGACCAAAGGGGAGACGATCCCGTCGACGTCGATTCGCATC ATCCGTAGTGTCGACGCGATGCGCGTCTGGCGTCGGCCGCAGACGCTCAATCACCGCAGCGTCGGGCTGGTGCCC ACCATGGGCGCGCTGCACCAAGGCCACCTTGCCCTGGTGCGCGAGGCGGCGCGACAAAACCACGAGGTTGTCGTG AGCCTCTTTGTCAACCCGGCCCAGTTTGGTGCCAACGAGGACTTGTCGTCGTATCCCGTCACCTGGGACACGGAT GTGCAGGCGCTGGCCCGGCTGGACCACGAGCTGGCCCAAGACGGCGCCAATCTGGGCCGCCTGGCTGTTGTATTT GCGCCCTCGGCCGACGTCATGTATCCCTCGGGCATCCACGGCCAACACGTGGACAGCAAGGGCAGCTTCGTCACC ATTACTCCTCTGGCCGAGCAGCTCGAGGGCGCCAGCCGCCCCACCTTTTTCCGCGGCGTCGCCACTGTCTGCATG AAGCTCTTCAACATTGTCCAGCCTGACCGCGTCTACTTTGGCCAAAAGGACGTGCAGCAGACGGTAATCATTCGC CGAATGGTGCGTGACTTTATGCTGCCTACTCAAGTCGTCGTTTGCCCCACGCAGCGCGATGCAGATGGCCTGGCG CTTAGCTCGCGCAACGTCTACCTCGGGCCGCGCCGCCGTTGCGTCGCCCTCGCCCTTGGCCGTGCCCTGCGCGCC GCCGAGGCTGCCTACCGTGCTGGCCAGCATGACGCCGCGCCCCTCTTGGCCGCTGCCCATGATGTATGTCGCGAC GTTTTGCGCGCCCAGGCCGCCCTCGCCCCCGACCAGCGCGCCCTCTTTGAAATTGACTACATCTCCCTGGCCGAT GTCGACAATTTGCAAGAGCTTGATGTCGTTGACCCTGCAAAGGGTGCTGTCATGAGTGCCGCCATCAAGATGCCG CCCCTTGAAAAGGTGCAGCCGGGAGAAGACGTTGGCCATGCCGGCGGACCCCAAGTCAGACTGCTTGACAATATT ATTCTTGAGCCTCTTTAG |
Transcript | >OphauG2|3032 ATGGCCTCTACCACGGCTACATGGCGCGGGCTGCAGACCAAAGGGGAGACGATCCCGTCGACGTCGATTCGCATC ATCCGTAGTGTCGACGCGATGCGCGTCTGGCGTCGGCCGCAGACGCTCAATCACCGCAGCGTCGGGCTGGTGCCC ACCATGGGCGCGCTGCACCAAGGCCACCTTGCCCTGGTGCGCGAGGCGGCGCGACAAAACCACGAGGTTGTCGTG AGCCTCTTTGTCAACCCGGCCCAGTTTGGTGCCAACGAGGACTTGTCGTCGTATCCCGTCACCTGGGACACGGAT GTGCAGGCGCTGGCCCGGCTGGACCACGAGCTGGCCCAAGACGGCGCCAATCTGGGCCGCCTGGCTGTTGTATTT GCGCCCTCGGCCGACGTCATGTATCCCTCGGGCATCCACGGCCAACACGTGGACAGCAAGGGCAGCTTCGTCACC ATTACTCCTCTGGCCGAGCAGCTCGAGGGCGCCAGCCGCCCCACCTTTTTCCGCGGCGTCGCCACTGTCTGCATG AAGCTCTTCAACATTGTCCAGCCTGACCGCGTCTACTTTGGCCAAAAGGACGTGCAGCAGACGGTAATCATTCGC CGAATGGTGCGTGACTTTATGCTGCCTACTCAAGTCGTCGTTTGCCCCACGCAGCGCGATGCAGATGGCCTGGCG CTTAGCTCGCGCAACGTCTACCTCGGGCCGCGCCGCCGTTGCGTCGCCCTCGCCCTTGGCCGTGCCCTGCGCGCC GCCGAGGCTGCCTACCGTGCTGGCCAGCATGACGCCGCGCCCCTCTTGGCCGCTGCCCATGATGTATGTCGCGAC GTTTTGCGCGCCCAGGCCGCCCTCGCCCCCGACCAGCGCGCCCTCTTTGAAATTGACTACATCTCCCTGGCCGAT GTCGACAATTTGCAAGAGCTTGATGTCGTTGACCCTGCAAAGGGTGCTGTCATGAGTGCCGCCATCAAGATGCCG CCCCTTGAAAAGGTGCAGCCGGGAGAAGACGTTGGCCATGCCGGCGGACCCCAAGTCAGACTGCTTGACAATATT ATTCTTGAGCCTCTTTAG |
Gene | >OphauG2|3032 ATGGCCTCTACCACGGCTACATGGCGCGGGCTGCAGACCAAAGGGGAGACGATCCCGTCGACGTCGATTCGCATC ATCCGTAGTGTCGACGCGATGCGCGTCTGGCGTCGGCCGCAGACGCTCAATCACCGCAGCGTCGGGCTGGTGCCC ACCATGGGCGCGCTGCACCAAGGCCACCTTGCCCTGGTGCGCGAGGCGGCGCGACAAAACCACGAGGTTGTCGTG AGCCTCTTTGTCAACCCGGCCCAGTTTGGTGCCAACGAGGACTTGTCGTCGTATCCCGTCACCTGGGACACGGAT GTGCAGGCGCTGGCCCGGCTGGACCACGAGCTGGCCCAAGACGGCGCCAATCTGGGCCGCCTGGCTGTTGTATTT GCGCCCTCGGCCGACGTCATGTATCCCTCGGGCATCCACGGCCAACACGTGGACAGCAAGGGCAGCTTCGTCACC ATTACTCCTCTGGCCGAGCAGCTCGAGGGCGCCAGCCGCCCCACCTTTTTCCGCGGCGTCGCCACTGTCTGCATG AAGCTCTTCAACATTGTCCAGCCTGACCGCGTCTACTTTGGCCAAAAGGACGTGCAGCAGACGGTAATCATTCGC CGAATGGTGCGTGACTTTATGCTGCCTACTCAAGTCGTCGTTTGCCCCACGCAGCGCGATGCAGATGGCCTGGCG CTTAGCTCGCGCAACGTCTACCTCGGGCCGCGCCGCCGTTGCGTCGCCCTCGCCCTTGGCCGTGCCCTGCGCGCC GCCGAGGCTGCCTACCGTGCTGGCCAGCATGACGCCGCGCCCCTCTTGGCCGCTGCCCATGATGTATGTCGCGAC GTTTTGCGCGCCCAGGCCGCCCTCGCCCCCGACCAGCGCGCCCTCTTTGAAATTGACTACATCTCCCTGGCCGAT GTCGACAATTTGCAAGAGCTTGATGTCGTTGACCCTGCAAAGGGTGCTGTCATGAGTGCCGCCATCAAGATGCCG CCCCTTGAAAAGGTGCAGCCGGGAGAAGACGTTGGCCATGCCGGCGGACCCCAAGTCAGACTGCTTGACAATATT ATTCTTGAGCCTCTTTAG |