Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3031
Gene name
LocationContig_222:6861..9504
Strand+
Gene length (bp)2643
Transcript length (bp)2505
Coding sequence length (bp)2505
Protein length (aa) 835

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19277 GPAT_C Glycerol-3-phosphate acyltransferase C-terminal region 1.0E-159 346 762
PF01553 Acyltransferase Acyltransferase 8.7E-17 207 334

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O15228|GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens GN=GNPAT PE=1 SV=1 91 654 1.0E-48
sp|A4IF87|GNPAT_BOVIN Dihydroxyacetone phosphate acyltransferase OS=Bos taurus GN=GNPAT PE=2 SV=1 91 707 2.0E-47
sp|Q886Q7|PLSB_PSESM Glycerol-3-phosphate acyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=plsB PE=3 SV=1 93 542 4.0E-46
sp|A6VQ68|PLSB_ACTSZ Glycerol-3-phosphate acyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=plsB PE=3 SV=1 148 542 6.0E-46
sp|Q9CLN7|PLSB_PASMU Glycerol-3-phosphate acyltransferase OS=Pasteurella multocida (strain Pm70) GN=plsB PE=3 SV=1 141 542 9.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O15228|GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens GN=GNPAT PE=1 SV=1 91 654 1.0E-48
sp|A4IF87|GNPAT_BOVIN Dihydroxyacetone phosphate acyltransferase OS=Bos taurus GN=GNPAT PE=2 SV=1 91 707 2.0E-47
sp|Q886Q7|PLSB_PSESM Glycerol-3-phosphate acyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=plsB PE=3 SV=1 93 542 4.0E-46
sp|A6VQ68|PLSB_ACTSZ Glycerol-3-phosphate acyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=plsB PE=3 SV=1 148 542 6.0E-46
sp|Q9CLN7|PLSB_PASMU Glycerol-3-phosphate acyltransferase OS=Pasteurella multocida (strain Pm70) GN=plsB PE=3 SV=1 141 542 9.0E-46
sp|A4XWX9|PLSB_PSEMY Glycerol-3-phosphate acyltransferase OS=Pseudomonas mendocina (strain ymp) GN=plsB PE=3 SV=1 159 542 3.0E-45
sp|Q9ES71|GNPAT_RAT Dihydroxyacetone phosphate acyltransferase OS=Rattus norvegicus GN=Gnpat PE=1 SV=1 91 582 3.0E-45
sp|Q4ZWU3|PLSB_PSEU2 Glycerol-3-phosphate acyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=plsB PE=3 SV=1 93 542 3.0E-45
sp|P98192|GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus GN=Gnpat PE=1 SV=1 91 722 1.0E-44
sp|B4EYR5|PLSB_PROMH Glycerol-3-phosphate acyltransferase OS=Proteus mirabilis (strain HI4320) GN=plsB PE=3 SV=1 184 585 3.0E-44
sp|Q4KHJ1|PLSB_PSEF5 Glycerol-3-phosphate acyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=plsB PE=3 SV=1 93 542 3.0E-44
sp|Q3KHC9|PLSB_PSEPF Glycerol-3-phosphate acyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=plsB PE=3 SV=1 93 542 4.0E-44
sp|B8F321|PLSB_HAEPS Glycerol-3-phosphate acyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=plsB PE=3 SV=1 151 542 7.0E-44
sp|Q88MQ0|PLSB_PSEPK Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain KT2440) GN=plsB PE=3 SV=1 209 609 7.0E-44
sp|Q1I610|PLSB_PSEE4 Glycerol-3-phosphate acyltransferase OS=Pseudomonas entomophila (strain L48) GN=plsB PE=3 SV=1 209 542 9.0E-44
sp|P44857|PLSB_HAEIN Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=plsB PE=3 SV=1 148 542 1.0E-43
sp|B7LL13|PLSB_ESCF3 Glycerol-3-phosphate acyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=plsB PE=3 SV=1 148 582 1.0E-43
sp|A5UHQ2|PLSB_HAEIG Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain PittGG) GN=plsB PE=3 SV=1 148 542 2.0E-43
sp|Q4QMF0|PLSB_HAEI8 Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=plsB PE=3 SV=1 148 542 2.0E-43
sp|A5UDX7|PLSB_HAEIE Glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain PittEE) GN=plsB PE=3 SV=1 148 542 2.0E-43
sp|B1JBS6|PLSB_PSEPW Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain W619) GN=plsB PE=3 SV=1 209 542 2.0E-43
sp|Q0I2G8|PLSB_HAES1 Glycerol-3-phosphate acyltransferase OS=Haemophilus somnus (strain 129Pt) GN=plsB PE=3 SV=1 184 546 2.0E-43
sp|A1SBC6|PLSB_SHEAM Glycerol-3-phosphate acyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=plsB PE=3 SV=1 130 607 2.0E-43
sp|B0KS79|PLSB_PSEPG Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain GB-1) GN=plsB PE=3 SV=1 209 542 2.0E-43
sp|Q48F46|PLSB_PSE14 Glycerol-3-phosphate acyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=plsB PE=3 SV=1 93 542 3.0E-43
sp|Q15MZ1|PLSB_PSEA6 Glycerol-3-phosphate acyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=plsB PE=3 SV=1 149 547 3.0E-43
sp|A4W5F4|PLSB_ENT38 Glycerol-3-phosphate acyltransferase OS=Enterobacter sp. (strain 638) GN=plsB PE=3 SV=1 148 598 4.0E-43
sp|A4TRU7|PLSB_YERPP Glycerol-3-phosphate acyltransferase OS=Yersinia pestis (strain Pestoides F) GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|Q1CE96|PLSB_YERPN Glycerol-3-phosphate acyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|Q8ZJ18|PLSB_YERPE Glycerol-3-phosphate acyltransferase OS=Yersinia pestis GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|Q1C0T9|PLSB_YERPA Glycerol-3-phosphate acyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|A7FN98|PLSB_YERP3 Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|B1JNE5|PLSB_YERPY Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|B2K1U5|PLSB_YERPB Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|Q66FG9|PLSB_YERPS Glycerol-3-phosphate acyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=plsB PE=3 SV=1 152 604 4.0E-43
sp|A5W867|PLSB_PSEP1 Glycerol-3-phosphate acyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=plsB PE=3 SV=1 209 542 5.0E-43
sp|Q87KN0|PLSB_VIBPA Glycerol-3-phosphate acyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=plsB PE=3 SV=1 157 681 5.0E-43
sp|B5XXZ1|PLSB_KLEP3 Glycerol-3-phosphate acyltransferase OS=Klebsiella pneumoniae (strain 342) GN=plsB PE=3 SV=1 148 600 1.0E-42
sp|C3K4R1|PLSB_PSEFS Glycerol-3-phosphate acyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=plsB PE=3 SV=1 184 542 1.0E-42
sp|B2TX75|PLSB_SHIB3 Glycerol-3-phosphate acyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=plsB PE=3 SV=1 137 627 2.0E-42
sp|Q9HXW7|PLSB_PSEAE Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plsB PE=3 SV=1 64 542 2.0E-42
sp|B7V2U0|PLSB_PSEA8 Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=plsB PE=3 SV=1 64 542 2.0E-42
sp|A6V1B5|PLSB_PSEA7 Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=plsB PE=3 SV=1 64 542 2.0E-42
sp|A6TGV0|PLSB_KLEP7 Glycerol-3-phosphate acyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=plsB PE=3 SV=1 148 542 3.0E-42
sp|B4S1W8|PLSB_ALTMD Glycerol-3-phosphate acyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=plsB PE=3 SV=1 167 548 4.0E-42
sp|Q02RE5|PLSB_PSEAB Glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=plsB PE=3 SV=1 64 542 4.0E-42
sp|B5Z182|PLSB_ECO5E Glycerol-3-phosphate acyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|P58130|PLSB_ECO57 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O157:H7 GN=plsB PE=3 SV=2 148 627 5.0E-42
sp|Q9PEJ7|PLSB_XYLFA Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=plsB PE=3 SV=1 164 545 5.0E-42
sp|B7NFY5|PLSB_ECOLU Glycerol-3-phosphate acyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|P0A7A7|PLSB_ECOLI Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) GN=plsB PE=1 SV=2 148 627 5.0E-42
sp|B1IUL1|PLSB_ECOLC Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|P0A7A8|PLSB_ECOL6 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=plsB PE=3 SV=2 148 627 5.0E-42
sp|A8A7E1|PLSB_ECOHS Glycerol-3-phosphate acyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|B1XC40|PLSB_ECODH Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|C5A134|PLSB_ECOBW Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|B7M7V4|PLSB_ECO8A Glycerol-3-phosphate acyltransferase OS=Escherichia coli O8 (strain IAI1) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|B7N2P8|PLSB_ECO81 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O81 (strain ED1a) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|B7NS05|PLSB_ECO7I Glycerol-3-phosphate acyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|B7LAY9|PLSB_ECO55 Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|B7MJ31|PLSB_ECO45 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|B7UPK2|PLSB_ECO27 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|A7ZUR3|PLSB_ECO24 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=plsB PE=3 SV=1 148 627 5.0E-42
sp|A3QIU8|PLSB_SHELP Glycerol-3-phosphate acyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=plsB PE=3 SV=1 157 621 5.0E-42
sp|Q7UBC6|PLSB_SHIFL Glycerol-3-phosphate acyltransferase OS=Shigella flexneri GN=plsB PE=3 SV=1 183 627 5.0E-42
sp|Q0SXQ8|PLSB_SHIF8 Glycerol-3-phosphate acyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=plsB PE=3 SV=1 183 627 5.0E-42
sp|B0U229|PLSB_XYLFM Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain M12) GN=plsB PE=3 SV=1 164 545 6.0E-42
sp|A1JRU2|PLSB_YERE8 Glycerol-3-phosphate acyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=plsB PE=3 SV=1 152 604 6.0E-42
sp|Q31TU9|PLSB_SHIBS Glycerol-3-phosphate acyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=plsB PE=3 SV=1 148 627 6.0E-42
sp|Q327U8|PLSB_SHIDS Glycerol-3-phosphate acyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=plsB PE=3 SV=1 148 627 6.0E-42
sp|Q1R3P5|PLSB_ECOUT Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=plsB PE=3 SV=1 148 627 6.0E-42
sp|B6I5Q6|PLSB_ECOSE Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain SE11) GN=plsB PE=3 SV=1 148 627 6.0E-42
sp|A1AIL8|PLSB_ECOK1 Glycerol-3-phosphate acyltransferase OS=Escherichia coli O1:K1 / APEC GN=plsB PE=3 SV=1 148 627 6.0E-42
sp|Q3YUU3|PLSB_SHISS Glycerol-3-phosphate acyltransferase OS=Shigella sonnei (strain Ss046) GN=plsB PE=3 SV=1 148 627 7.0E-42
sp|Q7VNI5|PLSB_HAEDU Glycerol-3-phosphate acyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=plsB PE=3 SV=1 148 542 9.0E-42
sp|B1LPK6|PLSB_ECOSM Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=plsB PE=3 SV=1 148 627 1.0E-41
sp|Q12ID7|PLSB_SHEDO Glycerol-3-phosphate acyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=plsB PE=3 SV=1 98 604 1.0E-41
sp|A8GKB6|PLSB_SERP5 Glycerol-3-phosphate acyltransferase OS=Serratia proteamaculans (strain 568) GN=plsB PE=3 SV=1 148 548 2.0E-41
sp|A3N1B3|PLSB_ACTP2 Glycerol-3-phosphate acyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=plsB PE=3 SV=1 106 542 2.0E-41
sp|Q8P3E3|PLSB_XANCP Glycerol-3-phosphate acyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=plsB PE=3 SV=1 164 545 2.0E-41
sp|A9MGP8|PLSB_SALAR Glycerol-3-phosphate acyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=plsB PE=3 SV=1 148 585 2.0E-41
sp|Q8Z1T6|PLSB_SALTI Glycerol-3-phosphate acyltransferase OS=Salmonella typhi GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|B5BJV8|PLSB_SALPK Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|Q5PL16|PLSB_SALPA Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|Q8ZKH9|PLSB_SALTY Glycerol-3-phosphate acyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|C0Q4E0|PLSB_SALPC Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|B4T1T0|PLSB_SALNS Glycerol-3-phosphate acyltransferase OS=Salmonella newport (strain SL254) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|B4TDL8|PLSB_SALHS Glycerol-3-phosphate acyltransferase OS=Salmonella heidelberg (strain SL476) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|B5R7T4|PLSB_SALG2 Glycerol-3-phosphate acyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|B5QZ60|PLSB_SALEP Glycerol-3-phosphate acyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|B5FQQ9|PLSB_SALDC Glycerol-3-phosphate acyltransferase OS=Salmonella dublin (strain CT_02021853) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|Q57GZ2|PLSB_SALCH Glycerol-3-phosphate acyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|B5F1Q4|PLSB_SALA4 Glycerol-3-phosphate acyltransferase OS=Salmonella agona (strain SL483) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|A9N1L4|PLSB_SALPB Glycerol-3-phosphate acyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=plsB PE=3 SV=1 148 639 3.0E-41
sp|Q8PES0|PLSB_XANAC Glycerol-3-phosphate acyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=plsB PE=3 SV=1 164 545 4.0E-41
sp|B6ENU1|PLSB_ALISL Glycerol-3-phosphate acyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=plsB PE=3 SV=1 152 569 5.0E-41
sp|B5FCB3|PLSB_VIBFM Glycerol-3-phosphate acyltransferase OS=Vibrio fischeri (strain MJ11) GN=plsB PE=3 SV=1 152 542 7.0E-41
sp|Q5E208|PLSB_VIBF1 Glycerol-3-phosphate acyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=plsB PE=3 SV=1 152 542 7.0E-41
sp|B4TQQ3|PLSB_SALSV Glycerol-3-phosphate acyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=plsB PE=3 SV=1 148 585 8.0E-41
sp|B0BQ47|PLSB_ACTPJ Glycerol-3-phosphate acyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=plsB PE=3 SV=1 148 542 9.0E-41
sp|B3GXZ3|PLSB_ACTP7 Glycerol-3-phosphate acyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=plsB PE=3 SV=1 148 542 9.0E-41
sp|B7VM97|PLSB_VIBTL Glycerol-3-phosphate acyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=plsB PE=3 SV=1 157 542 1.0E-40
sp|Q8DD48|PLSB_VIBVU Glycerol-3-phosphate acyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=plsB PE=3 SV=1 151 569 4.0E-40
sp|Q7MQ86|PLSB_VIBVY Glycerol-3-phosphate acyltransferase OS=Vibrio vulnificus (strain YJ016) GN=plsB PE=3 SV=1 151 569 4.0E-40
sp|Q87EJ1|PLSB_XYLFT Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=plsB PE=3 SV=1 164 545 5.0E-40
sp|B2I7N1|PLSB_XYLF2 Glycerol-3-phosphate acyltransferase OS=Xylella fastidiosa (strain M23) GN=plsB PE=3 SV=1 164 545 5.0E-40
sp|A5F4F5|PLSB_VIBC3 Glycerol-3-phosphate acyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=plsB PE=3 SV=1 157 590 5.0E-40
sp|C3LPT5|PLSB_VIBCM Glycerol-3-phosphate acyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=plsB PE=3 SV=1 157 590 6.0E-40
sp|Q9KVP8|PLSB_VIBCH Glycerol-3-phosphate acyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=plsB PE=3 SV=1 157 590 6.0E-40
sp|C4K8M7|PLSB_HAMD5 Glycerol-3-phosphate acyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=plsB PE=3 SV=1 183 563 8.0E-40
sp|B0TNU4|PLSB_SHEHH Glycerol-3-phosphate acyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=plsB PE=3 SV=1 157 607 1.0E-39
sp|Q7MZB7|PLSB_PHOLL Glycerol-3-phosphate acyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plsB PE=3 SV=1 184 569 2.0E-39
sp|Q22949|PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans GN=acl-6 PE=3 SV=1 133 703 2.0E-39
sp|Q8E8Q9|PLSB_SHEON Glycerol-3-phosphate acyltransferase OS=Shewanella oneidensis (strain MR-1) GN=plsB PE=3 SV=1 98 595 3.0E-39
sp|Q61586|GPAT1_MOUSE Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Mus musculus GN=Gpam PE=1 SV=2 90 546 5.0E-39
sp|C5B706|PLSB_EDWI9 Glycerol-3-phosphate acyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=plsB PE=3 SV=1 152 542 5.0E-39
sp|Q5GJ77|GPAT1_BOVIN Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Bos taurus GN=GPAM PE=2 SV=1 153 568 6.0E-39
sp|Q48AL2|PLSB_COLP3 Glycerol-3-phosphate acyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=plsB PE=3 SV=1 174 542 6.0E-39
sp|B8CUW9|PLSB_SHEPW Glycerol-3-phosphate acyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=plsB PE=3 SV=1 157 604 9.0E-39
sp|A8H9R9|PLSB_SHEPA Glycerol-3-phosphate acyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=plsB PE=3 SV=1 157 584 1.0E-38
sp|P97564|GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus GN=Gpam PE=1 SV=3 151 546 1.0E-38
sp|F1S5L4|GPAT1_PIG Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Sus scrofa GN=GPAM PE=2 SV=3 211 564 2.0E-38
sp|Q0HDL6|PLSB_SHESM Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain MR-4) GN=plsB PE=3 SV=1 157 595 3.0E-38
sp|A9KUW7|PLSB_SHEB9 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS195) GN=plsB PE=3 SV=1 98 595 4.0E-38
sp|A6WU04|PLSB_SHEB8 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS185) GN=plsB PE=3 SV=1 98 595 4.0E-38
sp|A0L2D7|PLSB_SHESA Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain ANA-3) GN=plsB PE=3 SV=1 157 595 4.0E-38
sp|A3CYX8|PLSB_SHEB5 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=plsB PE=3 SV=1 98 595 4.0E-38
sp|Q0HPW7|PLSB_SHESR Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain MR-7) GN=plsB PE=3 SV=1 98 595 5.0E-38
sp|B8ECL8|PLSB_SHEB2 Glycerol-3-phosphate acyltransferase OS=Shewanella baltica (strain OS223) GN=plsB PE=3 SV=1 98 595 5.0E-38
sp|Q9HCL2|GPAT1_HUMAN Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Homo sapiens GN=GPAM PE=1 SV=3 204 556 9.0E-38
sp|Q089E1|PLSB_SHEFN Glycerol-3-phosphate acyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=plsB PE=3 SV=1 98 595 2.0E-37
sp|A8FPP1|PLSB_SHESH Glycerol-3-phosphate acyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=plsB PE=3 SV=1 157 545 2.0E-37
sp|Q2NR08|PLSB_SODGM Glycerol-3-phosphate acyltransferase OS=Sodalis glossinidius (strain morsitans) GN=plsB PE=3 SV=1 136 598 2.0E-37
sp|B1KM69|PLSB_SHEWM Glycerol-3-phosphate acyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=plsB PE=3 SV=1 157 618 2.0E-37
sp|A0KEQ0|PLSB_AERHH Glycerol-3-phosphate acyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=plsB PE=3 SV=1 157 576 7.0E-37
sp|Q6D9I7|PLSB_PECAS Glycerol-3-phosphate acyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=plsB PE=3 SV=1 152 600 8.0E-37
sp|C6DKD0|PLSB_PECCP Glycerol-3-phosphate acyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=plsB PE=3 SV=1 152 552 8.0E-37
sp|Q1LU65|PLSB_BAUCH Glycerol-3-phosphate acyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=plsB PE=3 SV=1 112 545 1.0E-36
sp|A4YC03|PLSB_SHEPC Glycerol-3-phosphate acyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=plsB PE=3 SV=1 98 545 1.0E-36
sp|A1RE94|PLSB_SHESW Glycerol-3-phosphate acyltransferase OS=Shewanella sp. (strain W3-18-1) GN=plsB PE=3 SV=1 98 545 2.0E-36
sp|Q9X7B0|PLSB_MYCLE Glycerol-3-phosphate acyltransferase OS=Mycobacterium leprae (strain TN) GN=plsB PE=3 SV=1 177 545 4.0E-35
sp|B8ZRA3|PLSB_MYCLB Glycerol-3-phosphate acyltransferase OS=Mycobacterium leprae (strain Br4923) GN=plsB PE=3 SV=1 177 545 4.0E-35
sp|Q3IF27|PLSB_PSEHT Glycerol-3-phosphate acyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=plsB PE=3 SV=1 148 546 5.0E-34
sp|C1AEU7|PLSB_MYCBT Glycerol-3-phosphate acyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=plsB PE=3 SV=1 204 545 2.0E-32
sp|A1KLH6|PLSB_MYCBP Glycerol-3-phosphate acyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=plsB PE=3 SV=1 204 545 2.0E-32
sp|P9WI60|PLSB_MYCTO Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plsB PE=3 SV=1 204 545 2.0E-32
sp|P9WI61|PLSB_MYCTU Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plsB PE=1 SV=1 204 545 2.0E-32
sp|A5U5H8|PLSB_MYCTA Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=plsB PE=3 SV=1 204 545 2.0E-32
sp|Q7TYH5|PLSB_MYCBO Glycerol-3-phosphate acyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=plsB PE=3 SV=1 204 545 9.0E-32
sp|B2HNJ0|PLSB_MYCMM Glycerol-3-phosphate acyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=plsB PE=3 SV=1 172 545 2.0E-30
sp|P9WI59|PLSB1_MYCTU Putative acyltransferase plsB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plsB1 PE=1 SV=1 171 586 7.0E-29
sp|P9WI58|PLSB1_MYCTO Putative acyltransferase plsB1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plsB1 PE=3 SV=1 171 586 7.0E-29
sp|P65735|PLSB1_MYCBO Putative acyltransferase plsB1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=plsB1 PE=3 SV=1 171 586 7.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5586
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3031 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1047
Ophiocordyceps camponoti-floridani Ophcf2|05555
Ophiocordyceps camponoti-rufipedis Ophun1|4404
Ophiocordyceps kimflemingae Ophio5|4228
Ophiocordyceps subramaniannii Hirsu2|7498

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3031
MAEEKSSFDAANDSAPDLQILGDEITLQPSGYVSPQGVVHEGKEEALLHQFASFRAEPLQFLREVSLYVSGQGWR
AYDRVIGQPVFYPGFSDNMKAAVLSTPLLQKRISQLAETRVKVEEDQGIISKHDKEYSVKRAHRLSVLETGLQQV
AEKLTEDMISKMESKTFIRSAYYLVTQLLTRAYHQGIHVSSEEVLRLRKVADIAAKKRHSIVFLPSHRSHVDYVS
LQLICYRLGLTLPVVVAGDNLNFPLVGSFLQHAGAMWIRRSFGDDALYTTLVQSYIDTLLHEGYNFECFIEGGRS
RTGKLLPPKFGILSFILDSILSGRVDDAIICPVSTQYDKVIETEGYVTELLGMPKKKENLADFLSGGSSVLSLQL
GRVDVRFHEPWSLRKFIDEQLSRFPSLPPGLDTHHHKPEVRAVREKLLRTLGYKVLGDINAVSVVMPTALIGTVL
LTLRGRGVGKQELMRRVEWLTGRIRAKGGRVAHFGNAPLSEIVDRGLEVLGKDLVGMVDGLAEPTYYAVDRFQLS
FYRNMTIHLFIYEALVSVAMYTRVKLGGGPSMQEISYQDLKAHVSFFSSLFRGEFIFSGEGLSVNLDKTLQGLEA
DHVVRLDRDDSGNVTTIGLSNEERRAGRENYDFYCFLIWPFIEASWLAAVSLMSLTPPLGESGDIWIEMAKAQDS
SQLLGKTLYHQGDLSYFEAVNKETLRNSYSRFEQDQMLHVVKSKDSKVPPRIQLDVLWRPPRNPKTGALLAEGKL
WDFTEKIASARREGKNRRDGATVSSRVLRMADDLGRRLFADVALSDRSGKAKAPSRLNREEKETLRRSVKDARQQ
GKLGGRSRL*
Coding >OphauG2|3031
ATGGCTGAAGAAAAAAGCTCCTTCGACGCAGCCAACGACTCGGCTCCTGATCTCCAGATCCTCGGCGATGAAATC
ACCCTACAGCCCAGCGGCTATGTAAGCCCTCAGGGCGTCGTGCACGAGGGAAAGGAAGAGGCGCTGCTTCATCAG
TTTGCATCCTTCCGCGCCGAGCCGCTGCAGTTCCTTCGCGAGGTCTCGCTCTACGTTTCGGGCCAGGGCTGGCGT
GCCTACGACCGTGTCATTGGACAGCCGGTTTTCTACCCCGGCTTCTCGGACAACATGAAGGCGGCCGTGCTCTCG
ACTCCTCTGCTGCAGAAACGCATATCACAGCTGGCTGAGACGCGTGTCAAAGTGGAGGAGGATCAAGGCATCATC
AGCAAGCACGACAAGGAGTACAGTGTCAAGCGTGCTCACAGGCTCAGCGTCCTCGAGACCGGCCTGCAGCAGGTG
GCAGAGAAGCTGACCGAGGACATGATATCCAAAATGGAGAGCAAGACCTTTATTCGCAGCGCCTACTATCTAGTT
ACGCAGCTCTTGACACGGGCATATCATCAAGGCATACACGTCTCGAGTGAAGAGGTATTGCGCCTGAGAAAGGTG
GCGGATATTGCTGCCAAGAAGAGGCATAGTATTGTCTTTCTGCCCAGCCATCGTTCACACGTCGACTATGTCTCA
CTGCAGCTCATCTGCTATCGCCTTGGCCTCACTCTCCCCGTCGTCGTGGCGGGAGACAACCTCAACTTTCCTCTG
GTTGGCAGCTTCCTGCAGCATGCCGGCGCCATGTGGATACGGAGGTCCTTTGGCGATGATGCCCTATACACAACC
TTGGTACAGAGCTACATTGATACTTTGTTGCATGAAGGCTATAACTTTGAGTGCTTCATTGAAGGCGGCCGGTCA
CGAACTGGGAAGCTGTTGCCCCCCAAGTTTGGTATTCTCAGCTTTATTCTCGATAGCATCTTGTCGGGTCGTGTC
GATGACGCCATAATATGCCCCGTCAGCACTCAGTACGACAAAGTCATTGAGACCGAAGGCTATGTCACGGAGCTT
CTTGGTATGCCCAAGAAGAAGGAAAACCTAGCCGATTTCTTATCTGGCGGCTCCTCGGTTCTCTCGCTGCAGCTG
GGACGAGTAGACGTGCGATTCCATGAGCCCTGGAGTCTTCGCAAGTTTATCGACGAACAGCTTTCGCGCTTTCCC
AGTCTCCCACCTGGCCTGGACACGCATCATCACAAGCCCGAGGTTAGAGCTGTCAGAGAAAAACTGCTGCGAACC
CTGGGGTACAAAGTCTTGGGAGACATCAATGCCGTGTCCGTCGTGATGCCCACGGCGCTCATTGGCACAGTACTG
CTCACCTTGCGTGGCCGCGGCGTGGGCAAGCAGGAACTGATGCGGCGCGTCGAGTGGCTGACTGGCCGCATCCGA
GCCAAGGGTGGTCGCGTGGCTCACTTTGGCAACGCGCCTCTGTCCGAGATAGTGGACCGAGGACTCGAGGTGCTG
GGCAAGGATCTTGTTGGAATGGTTGATGGTCTCGCAGAGCCAACGTACTATGCTGTCGATCGCTTCCAGCTTTCC
TTTTACCGCAACATGACGATTCATCTCTTTATATACGAGGCGCTCGTCAGCGTTGCCATGTACACTCGCGTCAAA
CTAGGAGGCGGTCCCTCGATGCAGGAAATCTCGTACCAAGACCTCAAGGCGCATGTCTCCTTTTTCTCGTCGCTC
TTCCGCGGCGAGTTTATCTTTTCGGGCGAGGGCCTGTCTGTGAATCTGGACAAGACACTACAAGGCCTCGAGGCC
GACCATGTGGTCCGCCTTGACCGTGACGACTCGGGCAACGTTACCACAATTGGTCTTTCTAATGAAGAGCGAAGG
GCAGGCCGCGAGAATTATGACTTTTATTGCTTCCTGATTTGGCCCTTTATCGAGGCCAGCTGGCTTGCGGCCGTG
TCTCTAATGAGTCTAACTCCGCCATTGGGGGAGAGCGGCGATATATGGATCGAAATGGCCAAGGCACAGGACAGC
TCTCAGCTGCTTGGCAAGACGCTCTACCATCAAGGCGACCTGTCGTACTTTGAGGCAGTCAACAAGGAGACGCTC
AGAAACTCGTACAGCCGCTTCGAGCAGGACCAAATGTTGCATGTGGTCAAGTCCAAGGACTCCAAGGTGCCTCCG
CGTATCCAGCTAGACGTCCTGTGGCGGCCGCCGCGCAATCCCAAGACGGGAGCGCTGCTGGCCGAGGGCAAGCTC
TGGGACTTTACAGAAAAGATTGCCAGCGCCCGTCGCGAGGGCAAGAACCGGCGCGATGGCGCAACTGTCAGCTCA
CGCGTGCTGCGCATGGCTGATGACTTGGGCCGTCGTCTCTTTGCCGACGTGGCCTTGAGCGACAGGAGCGGCAAG
GCCAAGGCGCCTAGCCGATTGAACCGCGAGGAGAAGGAGACGCTGCGGCGGAGCGTCAAGGATGCGCGGCAGCAG
GGCAAGCTGGGCGGCCGATCCCGTCTTTAG
Transcript >OphauG2|3031
ATGGCTGAAGAAAAAAGCTCCTTCGACGCAGCCAACGACTCGGCTCCTGATCTCCAGATCCTCGGCGATGAAATC
ACCCTACAGCCCAGCGGCTATGTAAGCCCTCAGGGCGTCGTGCACGAGGGAAAGGAAGAGGCGCTGCTTCATCAG
TTTGCATCCTTCCGCGCCGAGCCGCTGCAGTTCCTTCGCGAGGTCTCGCTCTACGTTTCGGGCCAGGGCTGGCGT
GCCTACGACCGTGTCATTGGACAGCCGGTTTTCTACCCCGGCTTCTCGGACAACATGAAGGCGGCCGTGCTCTCG
ACTCCTCTGCTGCAGAAACGCATATCACAGCTGGCTGAGACGCGTGTCAAAGTGGAGGAGGATCAAGGCATCATC
AGCAAGCACGACAAGGAGTACAGTGTCAAGCGTGCTCACAGGCTCAGCGTCCTCGAGACCGGCCTGCAGCAGGTG
GCAGAGAAGCTGACCGAGGACATGATATCCAAAATGGAGAGCAAGACCTTTATTCGCAGCGCCTACTATCTAGTT
ACGCAGCTCTTGACACGGGCATATCATCAAGGCATACACGTCTCGAGTGAAGAGGTATTGCGCCTGAGAAAGGTG
GCGGATATTGCTGCCAAGAAGAGGCATAGTATTGTCTTTCTGCCCAGCCATCGTTCACACGTCGACTATGTCTCA
CTGCAGCTCATCTGCTATCGCCTTGGCCTCACTCTCCCCGTCGTCGTGGCGGGAGACAACCTCAACTTTCCTCTG
GTTGGCAGCTTCCTGCAGCATGCCGGCGCCATGTGGATACGGAGGTCCTTTGGCGATGATGCCCTATACACAACC
TTGGTACAGAGCTACATTGATACTTTGTTGCATGAAGGCTATAACTTTGAGTGCTTCATTGAAGGCGGCCGGTCA
CGAACTGGGAAGCTGTTGCCCCCCAAGTTTGGTATTCTCAGCTTTATTCTCGATAGCATCTTGTCGGGTCGTGTC
GATGACGCCATAATATGCCCCGTCAGCACTCAGTACGACAAAGTCATTGAGACCGAAGGCTATGTCACGGAGCTT
CTTGGTATGCCCAAGAAGAAGGAAAACCTAGCCGATTTCTTATCTGGCGGCTCCTCGGTTCTCTCGCTGCAGCTG
GGACGAGTAGACGTGCGATTCCATGAGCCCTGGAGTCTTCGCAAGTTTATCGACGAACAGCTTTCGCGCTTTCCC
AGTCTCCCACCTGGCCTGGACACGCATCATCACAAGCCCGAGGTTAGAGCTGTCAGAGAAAAACTGCTGCGAACC
CTGGGGTACAAAGTCTTGGGAGACATCAATGCCGTGTCCGTCGTGATGCCCACGGCGCTCATTGGCACAGTACTG
CTCACCTTGCGTGGCCGCGGCGTGGGCAAGCAGGAACTGATGCGGCGCGTCGAGTGGCTGACTGGCCGCATCCGA
GCCAAGGGTGGTCGCGTGGCTCACTTTGGCAACGCGCCTCTGTCCGAGATAGTGGACCGAGGACTCGAGGTGCTG
GGCAAGGATCTTGTTGGAATGGTTGATGGTCTCGCAGAGCCAACGTACTATGCTGTCGATCGCTTCCAGCTTTCC
TTTTACCGCAACATGACGATTCATCTCTTTATATACGAGGCGCTCGTCAGCGTTGCCATGTACACTCGCGTCAAA
CTAGGAGGCGGTCCCTCGATGCAGGAAATCTCGTACCAAGACCTCAAGGCGCATGTCTCCTTTTTCTCGTCGCTC
TTCCGCGGCGAGTTTATCTTTTCGGGCGAGGGCCTGTCTGTGAATCTGGACAAGACACTACAAGGCCTCGAGGCC
GACCATGTGGTCCGCCTTGACCGTGACGACTCGGGCAACGTTACCACAATTGGTCTTTCTAATGAAGAGCGAAGG
GCAGGCCGCGAGAATTATGACTTTTATTGCTTCCTGATTTGGCCCTTTATCGAGGCCAGCTGGCTTGCGGCCGTG
TCTCTAATGAGTCTAACTCCGCCATTGGGGGAGAGCGGCGATATATGGATCGAAATGGCCAAGGCACAGGACAGC
TCTCAGCTGCTTGGCAAGACGCTCTACCATCAAGGCGACCTGTCGTACTTTGAGGCAGTCAACAAGGAGACGCTC
AGAAACTCGTACAGCCGCTTCGAGCAGGACCAAATGTTGCATGTGGTCAAGTCCAAGGACTCCAAGGTGCCTCCG
CGTATCCAGCTAGACGTCCTGTGGCGGCCGCCGCGCAATCCCAAGACGGGAGCGCTGCTGGCCGAGGGCAAGCTC
TGGGACTTTACAGAAAAGATTGCCAGCGCCCGTCGCGAGGGCAAGAACCGGCGCGATGGCGCAACTGTCAGCTCA
CGCGTGCTGCGCATGGCTGATGACTTGGGCCGTCGTCTCTTTGCCGACGTGGCCTTGAGCGACAGGAGCGGCAAG
GCCAAGGCGCCTAGCCGATTGAACCGCGAGGAGAAGGAGACGCTGCGGCGGAGCGTCAAGGATGCGCGGCAGCAG
GGCAAGCTGGGCGGCCGATCCCGTCTTTAG
Gene >OphauG2|3031
ATGGCTGAAGAAAAAAGCTCCTTCGACGCAGCCAACGACTCGGCTCCTGATCTCCAGATCCTCGGCGATGAAATC
ACCCTACAGCCCAGCGGCTATGTAAGCCCTCAGGGCGTCGTGCACGAGGGAAAGGAAGAGGCGCTGCTTCATCAG
TTTGCATCCTTCCGCGCCGAGCCGCTGCAGTAGGTGTCGCCCGAGTGCACAAGCTGCCCCGTCTACTAAAACCAT
GTGCCCTGCTCCAGGTTCCTTCGCGAGGTCTCGCTCTACGTTTCGGGCCAGGGCTGGCGTGCCTACGACCGTGTC
ATTGGACAGCCGGTTTTCTACCCCGGCTTCTCGGACAACATGAAGGCGGCCGTGCTCTCGACTCCTCTGCTGCAG
AAACGCATATCACAGCTGGCTGAGACGCGTGTCAAAGTGGAGGAGGATCAAGGCATCATCAGCAAGCACGACAAG
GAGTACAGTGTCAAGCGTGCTCACAGGCTCAGCGTCCTCGAGACCGGCCTGCAGCAGGTGGCAGAGAAGCTGACC
GAGGACATGATATCCAAAATGGAGAGCAAGACCTTTATTCGCAGCGCCTACTATCTAGTTACGCAGCTCTTGACA
CGGGCATATCATCAAGGCATACACGTCTCGAGTGAAGAGGTATTGCGCCTGAGAAAGGTGGCGGATATTGCTGCC
AAGAAGAGGCATAGTATTGTCTTTCTGCCCAGCCATCGTTCACACGTCGACTATGTCTCACTGCAGCTCATCTGC
TATCGCCTTGGCCTCACTCTCCCCGTCGTCGTGGCGGGAGACAACCTCAACTTTCCTCTGGTTGGCAGCTTCCTG
CAGCATGCCGGCGCCATGTGGATACGGAGGTCCTTTGGCGATGATGCCCTATACACAACCTTGGTACAGAGCTAC
ATTGATACTTTGTTGCATGAAGGCTATAACTTTGAGTGCTTCATTGAAGGCGGCCGGTCACGAACTGGGAAGCTG
TTGCCCCCCAAGTTTGGTATTCTCAGCTTTATTCTCGATAGCATCTTGTCGGGTCGTGTCGATGACGCCATAATA
TGCCCCGTCAGCACTCAGTACGACAAAGTCATTGAGACCGAAGGCTATGTCACGGAGCTTCTTGGTATGCCCAAG
AAGAAGGAAAACCTAGCCGATTTCTTATCTGGCGGCTCCTCGGTTCTCTCGCTGCAGCTGGGACGAGTAGACGTG
CGATTCCATGAGCCCTGGAGTCTTCGCAAGTTTATCGACGAACAGCTTTCGCGCTTTCCCAGTCTCCCACCTGGC
CTGGACACGCATCATCACAAGCCCGAGGTTAGAGCTGTCAGAGAAAAACTGCTGCGAACCCTGGGGTACAAAGTC
TTGGGAGACATCAATGCCGTGTCCGTCGTGATGCCCACGGCGCTCATTGGCACAGTACTGCTCACCTTGCGTGGC
CGCGGCGTGGGCAAGCAGGAACTGATGCGGCGCGTCGAGTGGCTGACTGGCCGCATCCGAGCCAAGGGTGGTCGC
GTGGCTCACTTTGGCAACGCGCCTCTGTCCGAGATAGTGGACCGAGGACTCGAGGTGCTGGGCAAGGATCTTGTT
GGAATGGTTGATGGTCTCGCAGAGCCAACGTACTATGCTGTCGATCGCTTCCAGCTTTCCTTTTACCGCAACATG
ACGATTCATCTCTTTATATACGAGGCGCTCGTCAGCGTTGCCATGTACACTCGCGTCAAACTAGGAGGCGGTCCC
TCGATGCAGGAAATCTCGTACCAAGACCTCAAGGCGCATGTCTCCTTTTTCTCGTCGCTCTTCCGCGGCGAGTTT
ATCTTTTCGGGCGAGGGCCTGTCTGTGAATCTGGACAAGACACTACAAGGCCTCGAGGCCGACCATGTGGTCCGC
CTTGACCGTGACGACTCGGGCAACGTTACCACAATTGGTCTTTCTAATGAAGAGCGAAGGGCAGGCCGCGAGAAT
TATGACTTTTATTGCTTCCTGATTTGGCCCTTTATCGAGGCCAGCTGGCTTGCGGCCGTGTCTCTAATGAGTCTA
ACTCCGCCATTGGGGGAGAGCGGCGATATATGGATCGAAATGGCCAAGGCACAGGACAGCTCTCAGCTGGTAAGT
TGACGTGACGCAGCAAAGCCCAGGCCAAGTTTTGGTCAAGTTTTGTGTACCCTCTCTGACTGCTTCGATCAGCTT
GGCAAGACGCTCTACCATCAAGGCGACCTGTCGTACTTTGAGGCAGTCAACAAGGAGACGCTCAGAAACTCGTAC
AGCCGCTTCGAGCAGGACCAAATGTTGCATGTGGTCAAGTCCAAGGACTCCAAGGTGCCTCCGCGTATCCAGCTA
GACGTCCTGTGGCGGCCGCCGCGCAATCCCAAGACGGGAGCGCTGCTGGCCGAGGGCAAGCTCTGGGACTTTACA
GAAAAGATTGCCAGCGCCCGTCGCGAGGGCAAGAACCGGCGCGATGGCGCAACTGTCAGCTCACGCGTGCTGCGC
ATGGCTGATGACTTGGGCCGTCGTCTCTTTGCCGACGTGGCCTTGAGCGACAGGAGCGGCAAGGCCAAGGCGCCT
AGCCGATTGAACCGCGAGGAGAAGGAGACGCTGCGGCGGAGCGTCAAGGATGCGCGGCAGCAGGGCAAGCTGGGC
GGCCGATCCCGTCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail